From 5145b76b8a41b71a7b3c06373959c12f3a22014b Mon Sep 17 00:00:00 2001 From: Taras Madan Date: Mon, 24 Jun 2024 14:30:25 +0200 Subject: vendor: add bigquery client library --- .../github.com/klauspost/compress/.gitattributes | 2 + vendor/github.com/klauspost/compress/.gitignore | 32 + .../github.com/klauspost/compress/.goreleaser.yml | 141 + vendor/github.com/klauspost/compress/LICENSE | 304 ++ vendor/github.com/klauspost/compress/README.md | 642 +++ vendor/github.com/klauspost/compress/SECURITY.md | 25 + .../github.com/klauspost/compress/compressible.go | 85 + vendor/github.com/klauspost/compress/fse/README.md | 79 + .../github.com/klauspost/compress/fse/bitreader.go | 122 + .../github.com/klauspost/compress/fse/bitwriter.go | 168 + .../klauspost/compress/fse/bytereader.go | 47 + .../github.com/klauspost/compress/fse/compress.go | 682 ++++ .../klauspost/compress/fse/decompress.go | 376 ++ vendor/github.com/klauspost/compress/fse/fse.go | 144 + vendor/github.com/klauspost/compress/gen.sh | 4 + .../github.com/klauspost/compress/huff0/.gitignore | 1 + .../github.com/klauspost/compress/huff0/README.md | 89 + .../klauspost/compress/huff0/bitreader.go | 229 ++ .../klauspost/compress/huff0/bitwriter.go | 103 + .../klauspost/compress/huff0/bytereader.go | 44 + .../klauspost/compress/huff0/compress.go | 749 ++++ .../klauspost/compress/huff0/decompress.go | 1167 ++++++ .../klauspost/compress/huff0/decompress_amd64.go | 226 ++ .../klauspost/compress/huff0/decompress_amd64.s | 830 ++++ .../klauspost/compress/huff0/decompress_generic.go | 299 ++ .../github.com/klauspost/compress/huff0/huff0.go | 337 ++ .../klauspost/compress/internal/cpuinfo/cpuinfo.go | 34 + .../compress/internal/cpuinfo/cpuinfo_amd64.go | 11 + .../compress/internal/cpuinfo/cpuinfo_amd64.s | 36 + .../klauspost/compress/internal/snapref/LICENSE | 27 + .../klauspost/compress/internal/snapref/decode.go | 264 ++ .../compress/internal/snapref/decode_other.go | 113 + .../klauspost/compress/internal/snapref/encode.go | 289 ++ .../compress/internal/snapref/encode_other.go | 250 ++ .../klauspost/compress/internal/snapref/snappy.go | 98 + vendor/github.com/klauspost/compress/s2sx.mod | 4 + vendor/github.com/klauspost/compress/s2sx.sum | 0 .../github.com/klauspost/compress/zstd/README.md | 441 +++ .../klauspost/compress/zstd/bitreader.go | 140 + .../klauspost/compress/zstd/bitwriter.go | 113 + .../github.com/klauspost/compress/zstd/blockdec.go | 726 ++++ .../github.com/klauspost/compress/zstd/blockenc.go | 874 ++++ .../klauspost/compress/zstd/blocktype_string.go | 85 + .../github.com/klauspost/compress/zstd/bytebuf.go | 131 + .../klauspost/compress/zstd/bytereader.go | 82 + .../klauspost/compress/zstd/decodeheader.go | 229 ++ .../github.com/klauspost/compress/zstd/decoder.go | 948 +++++ .../klauspost/compress/zstd/decoder_options.go | 169 + vendor/github.com/klauspost/compress/zstd/dict.go | 161 + .../github.com/klauspost/compress/zstd/enc_base.go | 173 + .../github.com/klauspost/compress/zstd/enc_best.go | 530 +++ .../klauspost/compress/zstd/enc_better.go | 1242 ++++++ .../klauspost/compress/zstd/enc_dfast.go | 1123 ++++++ .../github.com/klauspost/compress/zstd/enc_fast.go | 891 +++++ .../github.com/klauspost/compress/zstd/encoder.go | 624 +++ .../klauspost/compress/zstd/encoder_options.go | 339 ++ .../github.com/klauspost/compress/zstd/framedec.go | 413 ++ .../github.com/klauspost/compress/zstd/frameenc.go | 137 + .../klauspost/compress/zstd/fse_decoder.go | 307 ++ .../klauspost/compress/zstd/fse_decoder_amd64.go | 65 + .../klauspost/compress/zstd/fse_decoder_amd64.s | 126 + .../klauspost/compress/zstd/fse_decoder_generic.go | 72 + .../klauspost/compress/zstd/fse_encoder.go | 701 ++++ .../klauspost/compress/zstd/fse_predefined.go | 158 + vendor/github.com/klauspost/compress/zstd/hash.go | 35 + .../github.com/klauspost/compress/zstd/history.go | 116 + .../compress/zstd/internal/xxhash/LICENSE.txt | 22 + .../compress/zstd/internal/xxhash/README.md | 71 + .../compress/zstd/internal/xxhash/xxhash.go | 230 ++ .../compress/zstd/internal/xxhash/xxhash_amd64.s | 210 + .../compress/zstd/internal/xxhash/xxhash_arm64.s | 184 + .../compress/zstd/internal/xxhash/xxhash_asm.go | 16 + .../compress/zstd/internal/xxhash/xxhash_other.go | 76 + .../compress/zstd/internal/xxhash/xxhash_safe.go | 11 + .../klauspost/compress/zstd/matchlen_amd64.go | 16 + .../klauspost/compress/zstd/matchlen_amd64.s | 68 + .../klauspost/compress/zstd/matchlen_generic.go | 33 + .../github.com/klauspost/compress/zstd/seqdec.go | 508 +++ .../klauspost/compress/zstd/seqdec_amd64.go | 394 ++ .../klauspost/compress/zstd/seqdec_amd64.s | 4175 ++++++++++++++++++++ .../klauspost/compress/zstd/seqdec_generic.go | 237 ++ .../github.com/klauspost/compress/zstd/seqenc.go | 114 + .../github.com/klauspost/compress/zstd/snappy.go | 435 ++ vendor/github.com/klauspost/compress/zstd/zip.go | 141 + vendor/github.com/klauspost/compress/zstd/zstd.go | 121 + vendor/github.com/klauspost/cpuid/v2/.gitignore | 24 + .../github.com/klauspost/cpuid/v2/.goreleaser.yml | 74 + .../github.com/klauspost/cpuid/v2/CONTRIBUTING.txt | 35 + vendor/github.com/klauspost/cpuid/v2/LICENSE | 22 + vendor/github.com/klauspost/cpuid/v2/README.md | 493 +++ vendor/github.com/klauspost/cpuid/v2/cpuid.go | 1427 +++++++ vendor/github.com/klauspost/cpuid/v2/cpuid_386.s | 47 + vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s | 72 + vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s | 26 + .../github.com/klauspost/cpuid/v2/detect_arm64.go | 247 ++ vendor/github.com/klauspost/cpuid/v2/detect_ref.go | 15 + vendor/github.com/klauspost/cpuid/v2/detect_x86.go | 36 + .../klauspost/cpuid/v2/featureid_string.go | 272 ++ .../klauspost/cpuid/v2/os_darwin_arm64.go | 121 + .../klauspost/cpuid/v2/os_linux_arm64.go | 130 + .../klauspost/cpuid/v2/os_other_arm64.go | 16 + .../klauspost/cpuid/v2/os_safe_linux_arm64.go | 8 + .../klauspost/cpuid/v2/os_unsafe_linux_arm64.go | 11 + .../klauspost/cpuid/v2/test-architectures.sh | 15 + 104 files changed, 29357 insertions(+) create mode 100644 vendor/github.com/klauspost/compress/.gitattributes create mode 100644 vendor/github.com/klauspost/compress/.gitignore create mode 100644 vendor/github.com/klauspost/compress/.goreleaser.yml create mode 100644 vendor/github.com/klauspost/compress/LICENSE create mode 100644 vendor/github.com/klauspost/compress/README.md create mode 100644 vendor/github.com/klauspost/compress/SECURITY.md create mode 100644 vendor/github.com/klauspost/compress/compressible.go create mode 100644 vendor/github.com/klauspost/compress/fse/README.md create mode 100644 vendor/github.com/klauspost/compress/fse/bitreader.go create mode 100644 vendor/github.com/klauspost/compress/fse/bitwriter.go create mode 100644 vendor/github.com/klauspost/compress/fse/bytereader.go create mode 100644 vendor/github.com/klauspost/compress/fse/compress.go create mode 100644 vendor/github.com/klauspost/compress/fse/decompress.go create mode 100644 vendor/github.com/klauspost/compress/fse/fse.go create mode 100644 vendor/github.com/klauspost/compress/gen.sh create mode 100644 vendor/github.com/klauspost/compress/huff0/.gitignore create mode 100644 vendor/github.com/klauspost/compress/huff0/README.md create mode 100644 vendor/github.com/klauspost/compress/huff0/bitreader.go create mode 100644 vendor/github.com/klauspost/compress/huff0/bitwriter.go create mode 100644 vendor/github.com/klauspost/compress/huff0/bytereader.go create mode 100644 vendor/github.com/klauspost/compress/huff0/compress.go create mode 100644 vendor/github.com/klauspost/compress/huff0/decompress.go create mode 100644 vendor/github.com/klauspost/compress/huff0/decompress_amd64.go create mode 100644 vendor/github.com/klauspost/compress/huff0/decompress_amd64.s create mode 100644 vendor/github.com/klauspost/compress/huff0/decompress_generic.go create mode 100644 vendor/github.com/klauspost/compress/huff0/huff0.go create mode 100644 vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo.go create mode 100644 vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo_amd64.go create mode 100644 vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo_amd64.s create mode 100644 vendor/github.com/klauspost/compress/internal/snapref/LICENSE create mode 100644 vendor/github.com/klauspost/compress/internal/snapref/decode.go create mode 100644 vendor/github.com/klauspost/compress/internal/snapref/decode_other.go create mode 100644 vendor/github.com/klauspost/compress/internal/snapref/encode.go create mode 100644 vendor/github.com/klauspost/compress/internal/snapref/encode_other.go create mode 100644 vendor/github.com/klauspost/compress/internal/snapref/snappy.go create mode 100644 vendor/github.com/klauspost/compress/s2sx.mod create mode 100644 vendor/github.com/klauspost/compress/s2sx.sum create mode 100644 vendor/github.com/klauspost/compress/zstd/README.md create mode 100644 vendor/github.com/klauspost/compress/zstd/bitreader.go create mode 100644 vendor/github.com/klauspost/compress/zstd/bitwriter.go create mode 100644 vendor/github.com/klauspost/compress/zstd/blockdec.go create mode 100644 vendor/github.com/klauspost/compress/zstd/blockenc.go create mode 100644 vendor/github.com/klauspost/compress/zstd/blocktype_string.go create mode 100644 vendor/github.com/klauspost/compress/zstd/bytebuf.go create mode 100644 vendor/github.com/klauspost/compress/zstd/bytereader.go create mode 100644 vendor/github.com/klauspost/compress/zstd/decodeheader.go create mode 100644 vendor/github.com/klauspost/compress/zstd/decoder.go create mode 100644 vendor/github.com/klauspost/compress/zstd/decoder_options.go create mode 100644 vendor/github.com/klauspost/compress/zstd/dict.go create mode 100644 vendor/github.com/klauspost/compress/zstd/enc_base.go create mode 100644 vendor/github.com/klauspost/compress/zstd/enc_best.go create mode 100644 vendor/github.com/klauspost/compress/zstd/enc_better.go create mode 100644 vendor/github.com/klauspost/compress/zstd/enc_dfast.go create mode 100644 vendor/github.com/klauspost/compress/zstd/enc_fast.go create mode 100644 vendor/github.com/klauspost/compress/zstd/encoder.go create mode 100644 vendor/github.com/klauspost/compress/zstd/encoder_options.go create mode 100644 vendor/github.com/klauspost/compress/zstd/framedec.go create mode 100644 vendor/github.com/klauspost/compress/zstd/frameenc.go create mode 100644 vendor/github.com/klauspost/compress/zstd/fse_decoder.go create mode 100644 vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.go create mode 100644 vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.s create mode 100644 vendor/github.com/klauspost/compress/zstd/fse_decoder_generic.go create mode 100644 vendor/github.com/klauspost/compress/zstd/fse_encoder.go create mode 100644 vendor/github.com/klauspost/compress/zstd/fse_predefined.go create mode 100644 vendor/github.com/klauspost/compress/zstd/hash.go create mode 100644 vendor/github.com/klauspost/compress/zstd/history.go create mode 100644 vendor/github.com/klauspost/compress/zstd/internal/xxhash/LICENSE.txt create mode 100644 vendor/github.com/klauspost/compress/zstd/internal/xxhash/README.md create mode 100644 vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash.go create mode 100644 vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.s create mode 100644 vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_arm64.s create mode 100644 vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_asm.go create mode 100644 vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_other.go create mode 100644 vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_safe.go create mode 100644 vendor/github.com/klauspost/compress/zstd/matchlen_amd64.go create mode 100644 vendor/github.com/klauspost/compress/zstd/matchlen_amd64.s create mode 100644 vendor/github.com/klauspost/compress/zstd/matchlen_generic.go create mode 100644 vendor/github.com/klauspost/compress/zstd/seqdec.go create mode 100644 vendor/github.com/klauspost/compress/zstd/seqdec_amd64.go create mode 100644 vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s create mode 100644 vendor/github.com/klauspost/compress/zstd/seqdec_generic.go create mode 100644 vendor/github.com/klauspost/compress/zstd/seqenc.go create mode 100644 vendor/github.com/klauspost/compress/zstd/snappy.go create mode 100644 vendor/github.com/klauspost/compress/zstd/zip.go create mode 100644 vendor/github.com/klauspost/compress/zstd/zstd.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/.gitignore create mode 100644 vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml create mode 100644 vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt create mode 100644 vendor/github.com/klauspost/cpuid/v2/LICENSE create mode 100644 vendor/github.com/klauspost/cpuid/v2/README.md create mode 100644 vendor/github.com/klauspost/cpuid/v2/cpuid.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/cpuid_386.s create mode 100644 vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s create mode 100644 vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s create mode 100644 vendor/github.com/klauspost/cpuid/v2/detect_arm64.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/detect_ref.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/detect_x86.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/featureid_string.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go create mode 100644 vendor/github.com/klauspost/cpuid/v2/test-architectures.sh (limited to 'vendor/github.com/klauspost') diff --git a/vendor/github.com/klauspost/compress/.gitattributes b/vendor/github.com/klauspost/compress/.gitattributes new file mode 100644 index 000000000..402433593 --- /dev/null +++ b/vendor/github.com/klauspost/compress/.gitattributes @@ -0,0 +1,2 @@ +* -text +*.bin -text -diff diff --git a/vendor/github.com/klauspost/compress/.gitignore b/vendor/github.com/klauspost/compress/.gitignore new file mode 100644 index 000000000..d31b37815 --- /dev/null +++ b/vendor/github.com/klauspost/compress/.gitignore @@ -0,0 +1,32 @@ +# Compiled Object files, Static and Dynamic libs (Shared Objects) +*.o +*.a +*.so + +# Folders +_obj +_test + +# Architecture specific extensions/prefixes +*.[568vq] +[568vq].out + +*.cgo1.go +*.cgo2.c +_cgo_defun.c +_cgo_gotypes.go +_cgo_export.* + +_testmain.go + +*.exe +*.test +*.prof +/s2/cmd/_s2sx/sfx-exe + +# Linux perf files +perf.data +perf.data.old + +# gdb history +.gdb_history diff --git a/vendor/github.com/klauspost/compress/.goreleaser.yml b/vendor/github.com/klauspost/compress/.goreleaser.yml new file mode 100644 index 000000000..7a008a4d2 --- /dev/null +++ b/vendor/github.com/klauspost/compress/.goreleaser.yml @@ -0,0 +1,141 @@ +# This is an example goreleaser.yaml file with some sane defaults. +# Make sure to check the documentation at http://goreleaser.com +before: + hooks: + - ./gen.sh + - go install mvdan.cc/garble@v0.9.3 + +builds: + - + id: "s2c" + binary: s2c + main: ./s2/cmd/s2c/main.go + flags: + - -trimpath + env: + - CGO_ENABLED=0 + goos: + - aix + - linux + - freebsd + - netbsd + - windows + - darwin + goarch: + - 386 + - amd64 + - arm + - arm64 + - ppc64 + - ppc64le + - mips64 + - mips64le + goarm: + - 7 + gobinary: garble + - + id: "s2d" + binary: s2d + main: ./s2/cmd/s2d/main.go + flags: + - -trimpath + env: + - CGO_ENABLED=0 + goos: + - aix + - linux + - freebsd + - netbsd + - windows + - darwin + goarch: + - 386 + - amd64 + - arm + - arm64 + - ppc64 + - ppc64le + - mips64 + - mips64le + goarm: + - 7 + gobinary: garble + - + id: "s2sx" + binary: s2sx + main: ./s2/cmd/_s2sx/main.go + flags: + - -modfile=s2sx.mod + - -trimpath + env: + - CGO_ENABLED=0 + goos: + - aix + - linux + - freebsd + - netbsd + - windows + - darwin + goarch: + - 386 + - amd64 + - arm + - arm64 + - ppc64 + - ppc64le + - mips64 + - mips64le + goarm: + - 7 + gobinary: garble + +archives: + - + id: s2-binaries + name_template: "s2-{{ .Os }}_{{ .Arch }}_{{ .Version }}" + replacements: + aix: AIX + darwin: OSX + linux: Linux + windows: Windows + 386: i386 + amd64: x86_64 + freebsd: FreeBSD + netbsd: NetBSD + format_overrides: + - goos: windows + format: zip + files: + - unpack/* + - s2/LICENSE + - s2/README.md +checksum: + name_template: 'checksums.txt' +snapshot: + name_template: "{{ .Tag }}-next" +changelog: + sort: asc + filters: + exclude: + - '^doc:' + - '^docs:' + - '^test:' + - '^tests:' + - '^Update\sREADME.md' + +nfpms: + - + file_name_template: "s2_package_{{ .Version }}_{{ .Os }}_{{ .Arch }}" + vendor: Klaus Post + homepage: https://github.com/klauspost/compress + maintainer: Klaus Post + description: S2 Compression Tool + license: BSD 3-Clause + formats: + - deb + - rpm + replacements: + darwin: Darwin + linux: Linux + freebsd: FreeBSD + amd64: x86_64 diff --git a/vendor/github.com/klauspost/compress/LICENSE b/vendor/github.com/klauspost/compress/LICENSE new file mode 100644 index 000000000..87d557477 --- /dev/null +++ b/vendor/github.com/klauspost/compress/LICENSE @@ -0,0 +1,304 @@ +Copyright (c) 2012 The Go Authors. All rights reserved. +Copyright (c) 2019 Klaus Post. All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +------------------ + +Files: gzhttp/* + + Apache License + Version 2.0, January 2004 + http://www.apache.org/licenses/ + + TERMS AND CONDITIONS FOR USE, REPRODUCTION, AND DISTRIBUTION + + 1. Definitions. + + "License" shall mean the terms and conditions for use, reproduction, + and distribution as defined by Sections 1 through 9 of this document. + + "Licensor" shall mean the copyright owner or entity authorized by + the copyright owner that is granting the License. + + "Legal Entity" shall mean the union of the acting entity and all + other entities that control, are controlled by, or are under common + control with that entity. For the purposes of this definition, + "control" means (i) the power, direct or indirect, to cause the + direction or management of such entity, whether by contract or + otherwise, or (ii) ownership of fifty percent (50%) or more of the + outstanding shares, or (iii) beneficial ownership of such entity. + + "You" (or "Your") shall mean an individual or Legal Entity + exercising permissions granted by this License. + + "Source" form shall mean the preferred form for making modifications, + including but not limited to software source code, documentation + source, and configuration files. + + "Object" form shall mean any form resulting from mechanical + transformation or translation of a Source form, including but + not limited to compiled object code, generated documentation, + and conversions to other media types. + + "Work" shall mean the work of authorship, whether in Source or + Object form, made available under the License, as indicated by a + copyright notice that is included in or attached to the work + (an example is provided in the Appendix below). + + "Derivative Works" shall mean any work, whether in Source or Object + form, that is based on (or derived from) the Work and for which the + editorial revisions, annotations, elaborations, or other modifications + represent, as a whole, an original work of authorship. For the purposes + of this License, Derivative Works shall not include works that remain + separable from, or merely link (or bind by name) to the interfaces of, + the Work and Derivative Works thereof. + + "Contribution" shall mean any work of authorship, including + the original version of the Work and any modifications or additions + to that Work or Derivative Works thereof, that is intentionally + submitted to Licensor for inclusion in the Work by the copyright owner + or by an individual or Legal Entity authorized to submit on behalf of + the copyright owner. For the purposes of this definition, "submitted" + means any form of electronic, verbal, or written communication sent + to the Licensor or its representatives, including but not limited to + communication on electronic mailing lists, source code control systems, + and issue tracking systems that are managed by, or on behalf of, the + Licensor for the purpose of discussing and improving the Work, but + excluding communication that is conspicuously marked or otherwise + designated in writing by the copyright owner as "Not a Contribution." + + "Contributor" shall mean Licensor and any individual or Legal Entity + on behalf of whom a Contribution has been received by Licensor and + subsequently incorporated within the Work. + + 2. Grant of Copyright License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + copyright license to reproduce, prepare Derivative Works of, + publicly display, publicly perform, sublicense, and distribute the + Work and such Derivative Works in Source or Object form. + + 3. Grant of Patent License. Subject to the terms and conditions of + this License, each Contributor hereby grants to You a perpetual, + worldwide, non-exclusive, no-charge, royalty-free, irrevocable + (except as stated in this section) patent license to make, have made, + use, offer to sell, sell, import, and otherwise transfer the Work, + where such license applies only to those patent claims licensable + by such Contributor that are necessarily infringed by their + Contribution(s) alone or by combination of their Contribution(s) + with the Work to which such Contribution(s) was submitted. If You + institute patent litigation against any entity (including a + cross-claim or counterclaim in a lawsuit) alleging that the Work + or a Contribution incorporated within the Work constitutes direct + or contributory patent infringement, then any patent licenses + granted to You under this License for that Work shall terminate + as of the date such litigation is filed. + + 4. Redistribution. You may reproduce and distribute copies of the + Work or Derivative Works thereof in any medium, with or without + modifications, and in Source or Object form, provided that You + meet the following conditions: + + (a) You must give any other recipients of the Work or + Derivative Works a copy of this License; and + + (b) You must cause any modified files to carry prominent notices + stating that You changed the files; and + + (c) You must retain, in the Source form of any Derivative Works + that You distribute, all copyright, patent, trademark, and + attribution notices from the Source form of the Work, + excluding those notices that do not pertain to any part of + the Derivative Works; and + + (d) If the Work includes a "NOTICE" text file as part of its + distribution, then any Derivative Works that You distribute must + include a readable copy of the attribution notices contained + within such NOTICE file, excluding those notices that do not + pertain to any part of the Derivative Works, in at least one + of the following places: within a NOTICE text file distributed + as part of the Derivative Works; within the Source form or + documentation, if provided along with the Derivative Works; or, + within a display generated by the Derivative Works, if and + wherever such third-party notices normally appear. The contents + of the NOTICE file are for informational purposes only and + do not modify the License. You may add Your own attribution + notices within Derivative Works that You distribute, alongside + or as an addendum to the NOTICE text from the Work, provided + that such additional attribution notices cannot be construed + as modifying the License. + + You may add Your own copyright statement to Your modifications and + may provide additional or different license terms and conditions + for use, reproduction, or distribution of Your modifications, or + for any such Derivative Works as a whole, provided Your use, + reproduction, and distribution of the Work otherwise complies with + the conditions stated in this License. + + 5. Submission of Contributions. Unless You explicitly state otherwise, + any Contribution intentionally submitted for inclusion in the Work + by You to the Licensor shall be under the terms and conditions of + this License, without any additional terms or conditions. + Notwithstanding the above, nothing herein shall supersede or modify + the terms of any separate license agreement you may have executed + with Licensor regarding such Contributions. + + 6. Trademarks. This License does not grant permission to use the trade + names, trademarks, service marks, or product names of the Licensor, + except as required for reasonable and customary use in describing the + origin of the Work and reproducing the content of the NOTICE file. + + 7. Disclaimer of Warranty. Unless required by applicable law or + agreed to in writing, Licensor provides the Work (and each + Contributor provides its Contributions) on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or + implied, including, without limitation, any warranties or conditions + of TITLE, NON-INFRINGEMENT, MERCHANTABILITY, or FITNESS FOR A + PARTICULAR PURPOSE. You are solely responsible for determining the + appropriateness of using or redistributing the Work and assume any + risks associated with Your exercise of permissions under this License. + + 8. Limitation of Liability. In no event and under no legal theory, + whether in tort (including negligence), contract, or otherwise, + unless required by applicable law (such as deliberate and grossly + negligent acts) or agreed to in writing, shall any Contributor be + liable to You for damages, including any direct, indirect, special, + incidental, or consequential damages of any character arising as a + result of this License or out of the use or inability to use the + Work (including but not limited to damages for loss of goodwill, + work stoppage, computer failure or malfunction, or any and all + other commercial damages or losses), even if such Contributor + has been advised of the possibility of such damages. + + 9. Accepting Warranty or Additional Liability. While redistributing + the Work or Derivative Works thereof, You may choose to offer, + and charge a fee for, acceptance of support, warranty, indemnity, + or other liability obligations and/or rights consistent with this + License. However, in accepting such obligations, You may act only + on Your own behalf and on Your sole responsibility, not on behalf + of any other Contributor, and only if You agree to indemnify, + defend, and hold each Contributor harmless for any liability + incurred by, or claims asserted against, such Contributor by reason + of your accepting any such warranty or additional liability. + + END OF TERMS AND CONDITIONS + + APPENDIX: How to apply the Apache License to your work. + + To apply the Apache License to your work, attach the following + boilerplate notice, with the fields enclosed by brackets "[]" + replaced with your own identifying information. (Don't include + the brackets!) The text should be enclosed in the appropriate + comment syntax for the file format. We also recommend that a + file or class name and description of purpose be included on the + same "printed page" as the copyright notice for easier + identification within third-party archives. + + Copyright 2016-2017 The New York Times Company + + Licensed under the Apache License, Version 2.0 (the "License"); + you may not use this file except in compliance with the License. + You may obtain a copy of the License at + + http://www.apache.org/licenses/LICENSE-2.0 + + Unless required by applicable law or agreed to in writing, software + distributed under the License is distributed on an "AS IS" BASIS, + WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. + See the License for the specific language governing permissions and + limitations under the License. + +------------------ + +Files: s2/cmd/internal/readahead/* + +The MIT License (MIT) + +Copyright (c) 2015 Klaus Post + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. + +--------------------- +Files: snappy/* +Files: internal/snapref/* + +Copyright (c) 2011 The Snappy-Go Authors. All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. + +----------------- + +Files: s2/cmd/internal/filepathx/* + +Copyright 2016 The filepathx Authors + +Permission is hereby granted, free of charge, to any person obtaining a copy of this software and associated documentation files (the "Software"), to deal in the Software without restriction, including without limitation the rights to use, copy, modify, merge, publish, distribute, sublicense, and/or sell copies of the Software, and to permit persons to whom the Software is furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. diff --git a/vendor/github.com/klauspost/compress/README.md b/vendor/github.com/klauspost/compress/README.md new file mode 100644 index 000000000..4002a16a6 --- /dev/null +++ b/vendor/github.com/klauspost/compress/README.md @@ -0,0 +1,642 @@ +# compress + +This package provides various compression algorithms. + +* [zstandard](https://github.com/klauspost/compress/tree/master/zstd#zstd) compression and decompression in pure Go. +* [S2](https://github.com/klauspost/compress/tree/master/s2#s2-compression) is a high performance replacement for Snappy. +* Optimized [deflate](https://godoc.org/github.com/klauspost/compress/flate) packages which can be used as a dropin replacement for [gzip](https://godoc.org/github.com/klauspost/compress/gzip), [zip](https://godoc.org/github.com/klauspost/compress/zip) and [zlib](https://godoc.org/github.com/klauspost/compress/zlib). +* [snappy](https://github.com/klauspost/compress/tree/master/snappy) is a drop-in replacement for `github.com/golang/snappy` offering better compression and concurrent streams. +* [huff0](https://github.com/klauspost/compress/tree/master/huff0) and [FSE](https://github.com/klauspost/compress/tree/master/fse) implementations for raw entropy encoding. +* [gzhttp](https://github.com/klauspost/compress/tree/master/gzhttp) Provides client and server wrappers for handling gzipped requests efficiently. +* [pgzip](https://github.com/klauspost/pgzip) is a separate package that provides a very fast parallel gzip implementation. + +[![Go Reference](https://pkg.go.dev/badge/klauspost/compress.svg)](https://pkg.go.dev/github.com/klauspost/compress?tab=subdirectories) +[![Go](https://github.com/klauspost/compress/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/compress/actions/workflows/go.yml) +[![Sourcegraph Badge](https://sourcegraph.com/github.com/klauspost/compress/-/badge.svg)](https://sourcegraph.com/github.com/klauspost/compress?badge) + +# changelog + +* June 13, 2023 - [v1.16.6](https://github.com/klauspost/compress/releases/tag/v1.16.6) + * zstd: correctly ignore WithEncoderPadding(1) by @ianlancetaylor in https://github.com/klauspost/compress/pull/806 + * zstd: Add amd64 match length assembly https://github.com/klauspost/compress/pull/824 + * gzhttp: Handle informational headers by @rtribotte in https://github.com/klauspost/compress/pull/815 + * s2: Improve Better compression slightly https://github.com/klauspost/compress/pull/663 + +* Apr 16, 2023 - [v1.16.5](https://github.com/klauspost/compress/releases/tag/v1.16.5) + * zstd: readByte needs to use io.ReadFull by @jnoxon in https://github.com/klauspost/compress/pull/802 + * gzip: Fix WriterTo after initial read https://github.com/klauspost/compress/pull/804 + +* Apr 5, 2023 - [v1.16.4](https://github.com/klauspost/compress/releases/tag/v1.16.4) + * zstd: Improve zstd best efficiency by @greatroar and @klauspost in https://github.com/klauspost/compress/pull/784 + * zstd: Respect WithAllLitEntropyCompression https://github.com/klauspost/compress/pull/792 + * zstd: Fix amd64 not always detecting corrupt data https://github.com/klauspost/compress/pull/785 + * zstd: Various minor improvements by @greatroar in https://github.com/klauspost/compress/pull/788 https://github.com/klauspost/compress/pull/794 https://github.com/klauspost/compress/pull/795 + * s2: Fix huge block overflow https://github.com/klauspost/compress/pull/779 + * s2: Allow CustomEncoder fallback https://github.com/klauspost/compress/pull/780 + * gzhttp: Suppport ResponseWriter Unwrap() in gzhttp handler by @jgimenez in https://github.com/klauspost/compress/pull/799 + +* Mar 13, 2023 - [v1.16.1](https://github.com/klauspost/compress/releases/tag/v1.16.1) + * zstd: Speed up + improve best encoder by @greatroar in https://github.com/klauspost/compress/pull/776 + * gzhttp: Add optional [BREACH mitigation](https://github.com/klauspost/compress/tree/master/gzhttp#breach-mitigation). https://github.com/klauspost/compress/pull/762 https://github.com/klauspost/compress/pull/768 https://github.com/klauspost/compress/pull/769 https://github.com/klauspost/compress/pull/770 https://github.com/klauspost/compress/pull/767 + * s2: Add Intel LZ4s converter https://github.com/klauspost/compress/pull/766 + * zstd: Minor bug fixes https://github.com/klauspost/compress/pull/771 https://github.com/klauspost/compress/pull/772 https://github.com/klauspost/compress/pull/773 + * huff0: Speed up compress1xDo by @greatroar in https://github.com/klauspost/compress/pull/774 + +* Feb 26, 2023 - [v1.16.0](https://github.com/klauspost/compress/releases/tag/v1.16.0) + * s2: Add [Dictionary](https://github.com/klauspost/compress/tree/master/s2#dictionaries) support. https://github.com/klauspost/compress/pull/685 + * s2: Add Compression Size Estimate. https://github.com/klauspost/compress/pull/752 + * s2: Add support for custom stream encoder. https://github.com/klauspost/compress/pull/755 + * s2: Add LZ4 block converter. https://github.com/klauspost/compress/pull/748 + * s2: Support io.ReaderAt in ReadSeeker. https://github.com/klauspost/compress/pull/747 + * s2c/s2sx: Use concurrent decoding. https://github.com/klauspost/compress/pull/746 + +* Jan 21st, 2023 (v1.15.15) + * deflate: Improve level 7-9 by @klauspost in https://github.com/klauspost/compress/pull/739 + * zstd: Add delta encoding support by @greatroar in https://github.com/klauspost/compress/pull/728 + * zstd: Various speed improvements by @greatroar https://github.com/klauspost/compress/pull/741 https://github.com/klauspost/compress/pull/734 https://github.com/klauspost/compress/pull/736 https://github.com/klauspost/compress/pull/744 https://github.com/klauspost/compress/pull/743 https://github.com/klauspost/compress/pull/745 + * gzhttp: Add SuffixETag() and DropETag() options to prevent ETag collisions on compressed responses by @willbicks in https://github.com/klauspost/compress/pull/740 + +* Jan 3rd, 2023 (v1.15.14) + + * flate: Improve speed in big stateless blocks https://github.com/klauspost/compress/pull/718 + * zstd: Minor speed tweaks by @greatroar in https://github.com/klauspost/compress/pull/716 https://github.com/klauspost/compress/pull/720 + * export NoGzipResponseWriter for custom ResponseWriter wrappers by @harshavardhana in https://github.com/klauspost/compress/pull/722 + * s2: Add example for indexing and existing stream https://github.com/klauspost/compress/pull/723 + +* Dec 11, 2022 (v1.15.13) + * zstd: Add [MaxEncodedSize](https://pkg.go.dev/github.com/klauspost/compress@v1.15.13/zstd#Encoder.MaxEncodedSize) to encoder https://github.com/klauspost/compress/pull/691 + * zstd: Various tweaks and improvements https://github.com/klauspost/compress/pull/693 https://github.com/klauspost/compress/pull/695 https://github.com/klauspost/compress/pull/696 https://github.com/klauspost/compress/pull/701 https://github.com/klauspost/compress/pull/702 https://github.com/klauspost/compress/pull/703 https://github.com/klauspost/compress/pull/704 https://github.com/klauspost/compress/pull/705 https://github.com/klauspost/compress/pull/706 https://github.com/klauspost/compress/pull/707 https://github.com/klauspost/compress/pull/708 + +* Oct 26, 2022 (v1.15.12) + + * zstd: Tweak decoder allocs. https://github.com/klauspost/compress/pull/680 + * gzhttp: Always delete `HeaderNoCompression` https://github.com/klauspost/compress/pull/683 + +* Sept 26, 2022 (v1.15.11) + + * flate: Improve level 1-3 compression https://github.com/klauspost/compress/pull/678 + * zstd: Improve "best" compression by @nightwolfz in https://github.com/klauspost/compress/pull/677 + * zstd: Fix+reduce decompression allocations https://github.com/klauspost/compress/pull/668 + * zstd: Fix non-effective noescape tag https://github.com/klauspost/compress/pull/667 + +* Sept 16, 2022 (v1.15.10) + + * zstd: Add [WithDecodeAllCapLimit](https://pkg.go.dev/github.com/klauspost/compress@v1.15.10/zstd#WithDecodeAllCapLimit) https://github.com/klauspost/compress/pull/649 + * Add Go 1.19 - deprecate Go 1.16 https://github.com/klauspost/compress/pull/651 + * flate: Improve level 5+6 compression https://github.com/klauspost/compress/pull/656 + * zstd: Improve "better" compresssion https://github.com/klauspost/compress/pull/657 + * s2: Improve "best" compression https://github.com/klauspost/compress/pull/658 + * s2: Improve "better" compression. https://github.com/klauspost/compress/pull/635 + * s2: Slightly faster non-assembly decompression https://github.com/klauspost/compress/pull/646 + * Use arrays for constant size copies https://github.com/klauspost/compress/pull/659 + +* July 21, 2022 (v1.15.9) + + * zstd: Fix decoder crash on amd64 (no BMI) on invalid input https://github.com/klauspost/compress/pull/645 + * zstd: Disable decoder extended memory copies (amd64) due to possible crashes https://github.com/klauspost/compress/pull/644 + * zstd: Allow single segments up to "max decoded size" by @klauspost in https://github.com/klauspost/compress/pull/643 + +* July 13, 2022 (v1.15.8) + + * gzip: fix stack exhaustion bug in Reader.Read https://github.com/klauspost/compress/pull/641 + * s2: Add Index header trim/restore https://github.com/klauspost/compress/pull/638 + * zstd: Optimize seqdeq amd64 asm by @greatroar in https://github.com/klauspost/compress/pull/636 + * zstd: Improve decoder memcopy https://github.com/klauspost/compress/pull/637 + * huff0: Pass a single bitReader pointer to asm by @greatroar in https://github.com/klauspost/compress/pull/634 + * zstd: Branchless getBits for amd64 w/o BMI2 by @greatroar in https://github.com/klauspost/compress/pull/640 + * gzhttp: Remove header before writing https://github.com/klauspost/compress/pull/639 + +* June 29, 2022 (v1.15.7) + + * s2: Fix absolute forward seeks https://github.com/klauspost/compress/pull/633 + * zip: Merge upstream https://github.com/klauspost/compress/pull/631 + * zip: Re-add zip64 fix https://github.com/klauspost/compress/pull/624 + * zstd: translate fseDecoder.buildDtable into asm by @WojciechMula in https://github.com/klauspost/compress/pull/598 + * flate: Faster histograms https://github.com/klauspost/compress/pull/620 + * deflate: Use compound hcode https://github.com/klauspost/compress/pull/622 + +* June 3, 2022 (v1.15.6) + * s2: Improve coding for long, close matches https://github.com/klauspost/compress/pull/613 + * s2c: Add Snappy/S2 stream recompression https://github.com/klauspost/compress/pull/611 + * zstd: Always use configured block size https://github.com/klauspost/compress/pull/605 + * zstd: Fix incorrect hash table placement for dict encoding in default https://github.com/klauspost/compress/pull/606 + * zstd: Apply default config to ZipDecompressor without options https://github.com/klauspost/compress/pull/608 + * gzhttp: Exclude more common archive formats https://github.com/klauspost/compress/pull/612 + * s2: Add ReaderIgnoreCRC https://github.com/klauspost/compress/pull/609 + * s2: Remove sanity load on index creation https://github.com/klauspost/compress/pull/607 + * snappy: Use dedicated function for scoring https://github.com/klauspost/compress/pull/614 + * s2c+s2d: Use official snappy framed extension https://github.com/klauspost/compress/pull/610 + +* May 25, 2022 (v1.15.5) + * s2: Add concurrent stream decompression https://github.com/klauspost/compress/pull/602 + * s2: Fix final emit oob read crash on amd64 https://github.com/klauspost/compress/pull/601 + * huff0: asm implementation of Decompress1X by @WojciechMula https://github.com/klauspost/compress/pull/596 + * zstd: Use 1 less goroutine for stream decoding https://github.com/klauspost/compress/pull/588 + * zstd: Copy literal in 16 byte blocks when possible https://github.com/klauspost/compress/pull/592 + * zstd: Speed up when WithDecoderLowmem(false) https://github.com/klauspost/compress/pull/599 + * zstd: faster next state update in BMI2 version of decode by @WojciechMula in https://github.com/klauspost/compress/pull/593 + * huff0: Do not check max size when reading table. https://github.com/klauspost/compress/pull/586 + * flate: Inplace hashing for level 7-9 by @klauspost in https://github.com/klauspost/compress/pull/590 + + +* May 11, 2022 (v1.15.4) + * huff0: decompress directly into output by @WojciechMula in [#577](https://github.com/klauspost/compress/pull/577) + * inflate: Keep dict on stack [#581](https://github.com/klauspost/compress/pull/581) + * zstd: Faster decoding memcopy in asm [#583](https://github.com/klauspost/compress/pull/583) + * zstd: Fix ignored crc [#580](https://github.com/klauspost/compress/pull/580) + +* May 5, 2022 (v1.15.3) + * zstd: Allow to ignore checksum checking by @WojciechMula [#572](https://github.com/klauspost/compress/pull/572) + * s2: Fix incorrect seek for io.SeekEnd in [#575](https://github.com/klauspost/compress/pull/575) + +* Apr 26, 2022 (v1.15.2) + * zstd: Add x86-64 assembly for decompression on streams and blocks. Contributed by [@WojciechMula](https://github.com/WojciechMula). Typically 2x faster. [#528](https://github.com/klauspost/compress/pull/528) [#531](https://github.com/klauspost/compress/pull/531) [#545](https://github.com/klauspost/compress/pull/545) [#537](https://github.com/klauspost/compress/pull/537) + * zstd: Add options to ZipDecompressor and fixes [#539](https://github.com/klauspost/compress/pull/539) + * s2: Use sorted search for index [#555](https://github.com/klauspost/compress/pull/555) + * Minimum version is Go 1.16, added CI test on 1.18. + +* Mar 11, 2022 (v1.15.1) + * huff0: Add x86 assembly of Decode4X by @WojciechMula in [#512](https://github.com/klauspost/compress/pull/512) + * zstd: Reuse zip decoders in [#514](https://github.com/klauspost/compress/pull/514) + * zstd: Detect extra block data and report as corrupted in [#520](https://github.com/klauspost/compress/pull/520) + * zstd: Handle zero sized frame content size stricter in [#521](https://github.com/klauspost/compress/pull/521) + * zstd: Add stricter block size checks in [#523](https://github.com/klauspost/compress/pull/523) + +* Mar 3, 2022 (v1.15.0) + * zstd: Refactor decoder by @klauspost in [#498](https://github.com/klauspost/compress/pull/498) + * zstd: Add stream encoding without goroutines by @klauspost in [#505](https://github.com/klauspost/compress/pull/505) + * huff0: Prevent single blocks exceeding 16 bits by @klauspost in[#507](https://github.com/klauspost/compress/pull/507) + * flate: Inline literal emission by @klauspost in [#509](https://github.com/klauspost/compress/pull/509) + * gzhttp: Add zstd to transport by @klauspost in [#400](https://github.com/klauspost/compress/pull/400) + * gzhttp: Make content-type optional by @klauspost in [#510](https://github.com/klauspost/compress/pull/510) + +Both compression and decompression now supports "synchronous" stream operations. This means that whenever "concurrency" is set to 1, they will operate without spawning goroutines. + +Stream decompression is now faster on asynchronous, since the goroutine allocation much more effectively splits the workload. On typical streams this will typically use 2 cores fully for decompression. When a stream has finished decoding no goroutines will be left over, so decoders can now safely be pooled and still be garbage collected. + +While the release has been extensively tested, it is recommended to testing when upgrading. + +
+ See changes to v1.14.x + +* Feb 22, 2022 (v1.14.4) + * flate: Fix rare huffman only (-2) corruption. [#503](https://github.com/klauspost/compress/pull/503) + * zip: Update deprecated CreateHeaderRaw to correctly call CreateRaw by @saracen in [#502](https://github.com/klauspost/compress/pull/502) + * zip: don't read data descriptor early by @saracen in [#501](https://github.com/klauspost/compress/pull/501) #501 + * huff0: Use static decompression buffer up to 30% faster by @klauspost in [#499](https://github.com/klauspost/compress/pull/499) [#500](https://github.com/klauspost/compress/pull/500) + +* Feb 17, 2022 (v1.14.3) + * flate: Improve fastest levels compression speed ~10% more throughput. [#482](https://github.com/klauspost/compress/pull/482) [#489](https://github.com/klauspost/compress/pull/489) [#490](https://github.com/klauspost/compress/pull/490) [#491](https://github.com/klauspost/compress/pull/491) [#494](https://github.com/klauspost/compress/pull/494) [#478](https://github.com/klauspost/compress/pull/478) + * flate: Faster decompression speed, ~5-10%. [#483](https://github.com/klauspost/compress/pull/483) + * s2: Faster compression with Go v1.18 and amd64 microarch level 3+. [#484](https://github.com/klauspost/compress/pull/484) [#486](https://github.com/klauspost/compress/pull/486) + +* Jan 25, 2022 (v1.14.2) + * zstd: improve header decoder by @dsnet [#476](https://github.com/klauspost/compress/pull/476) + * zstd: Add bigger default blocks [#469](https://github.com/klauspost/compress/pull/469) + * zstd: Remove unused decompression buffer [#470](https://github.com/klauspost/compress/pull/470) + * zstd: Fix logically dead code by @ningmingxiao [#472](https://github.com/klauspost/compress/pull/472) + * flate: Improve level 7-9 [#471](https://github.com/klauspost/compress/pull/471) [#473](https://github.com/klauspost/compress/pull/473) + * zstd: Add noasm tag for xxhash [#475](https://github.com/klauspost/compress/pull/475) + +* Jan 11, 2022 (v1.14.1) + * s2: Add stream index in [#462](https://github.com/klauspost/compress/pull/462) + * flate: Speed and efficiency improvements in [#439](https://github.com/klauspost/compress/pull/439) [#461](https://github.com/klauspost/compress/pull/461) [#455](https://github.com/klauspost/compress/pull/455) [#452](https://github.com/klauspost/compress/pull/452) [#458](https://github.com/klauspost/compress/pull/458) + * zstd: Performance improvement in [#420]( https://github.com/klauspost/compress/pull/420) [#456](https://github.com/klauspost/compress/pull/456) [#437](https://github.com/klauspost/compress/pull/437) [#467](https://github.com/klauspost/compress/pull/467) [#468](https://github.com/klauspost/compress/pull/468) + * zstd: add arm64 xxhash assembly in [#464](https://github.com/klauspost/compress/pull/464) + * Add garbled for binaries for s2 in [#445](https://github.com/klauspost/compress/pull/445) +
+ +
+ See changes to v1.13.x + +* Aug 30, 2021 (v1.13.5) + * gz/zlib/flate: Alias stdlib errors [#425](https://github.com/klauspost/compress/pull/425) + * s2: Add block support to commandline tools [#413](https://github.com/klauspost/compress/pull/413) + * zstd: pooledZipWriter should return Writers to the same pool [#426](https://github.com/klauspost/compress/pull/426) + * Removed golang/snappy as external dependency for tests [#421](https://github.com/klauspost/compress/pull/421) + +* Aug 12, 2021 (v1.13.4) + * Add [snappy replacement package](https://github.com/klauspost/compress/tree/master/snappy). + * zstd: Fix incorrect encoding in "best" mode [#415](https://github.com/klauspost/compress/pull/415) + +* Aug 3, 2021 (v1.13.3) + * zstd: Improve Best compression [#404](https://github.com/klauspost/compress/pull/404) + * zstd: Fix WriteTo error forwarding [#411](https://github.com/klauspost/compress/pull/411) + * gzhttp: Return http.HandlerFunc instead of http.Handler. Unlikely breaking change. [#406](https://github.com/klauspost/compress/pull/406) + * s2sx: Fix max size error [#399](https://github.com/klauspost/compress/pull/399) + * zstd: Add optional stream content size on reset [#401](https://github.com/klauspost/compress/pull/401) + * zstd: use SpeedBestCompression for level >= 10 [#410](https://github.com/klauspost/compress/pull/410) + +* Jun 14, 2021 (v1.13.1) + * s2: Add full Snappy output support [#396](https://github.com/klauspost/compress/pull/396) + * zstd: Add configurable [Decoder window](https://pkg.go.dev/github.com/klauspost/compress/zstd#WithDecoderMaxWindow) size [#394](https://github.com/klauspost/compress/pull/394) + * gzhttp: Add header to skip compression [#389](https://github.com/klauspost/compress/pull/389) + * s2: Improve speed with bigger output margin [#395](https://github.com/klauspost/compress/pull/395) + +* Jun 3, 2021 (v1.13.0) + * Added [gzhttp](https://github.com/klauspost/compress/tree/master/gzhttp#gzip-handler) which allows wrapping HTTP servers and clients with GZIP compressors. + * zstd: Detect short invalid signatures [#382](https://github.com/klauspost/compress/pull/382) + * zstd: Spawn decoder goroutine only if needed. [#380](https://github.com/klauspost/compress/pull/380) +
+ + +
+ See changes to v1.12.x + +* May 25, 2021 (v1.12.3) + * deflate: Better/faster Huffman encoding [#374](https://github.com/klauspost/compress/pull/374) + * deflate: Allocate less for history. [#375](https://github.com/klauspost/compress/pull/375) + * zstd: Forward read errors [#373](https://github.com/klauspost/compress/pull/373) + +* Apr 27, 2021 (v1.12.2) + * zstd: Improve better/best compression [#360](https://github.com/klauspost/compress/pull/360) [#364](https://github.com/klauspost/compress/pull/364) [#365](https://github.com/klauspost/compress/pull/365) + * zstd: Add helpers to compress/decompress zstd inside zip files [#363](https://github.com/klauspost/compress/pull/363) + * deflate: Improve level 5+6 compression [#367](https://github.com/klauspost/compress/pull/367) + * s2: Improve better/best compression [#358](https://github.com/klauspost/compress/pull/358) [#359](https://github.com/klauspost/compress/pull/358) + * s2: Load after checking src limit on amd64. [#362](https://github.com/klauspost/compress/pull/362) + * s2sx: Limit max executable size [#368](https://github.com/klauspost/compress/pull/368) + +* Apr 14, 2021 (v1.12.1) + * snappy package removed. Upstream added as dependency. + * s2: Better compression in "best" mode [#353](https://github.com/klauspost/compress/pull/353) + * s2sx: Add stdin input and detect pre-compressed from signature [#352](https://github.com/klauspost/compress/pull/352) + * s2c/s2d: Add http as possible input [#348](https://github.com/klauspost/compress/pull/348) + * s2c/s2d/s2sx: Always truncate when writing files [#352](https://github.com/klauspost/compress/pull/352) + * zstd: Reduce memory usage further when using [WithLowerEncoderMem](https://pkg.go.dev/github.com/klauspost/compress/zstd#WithLowerEncoderMem) [#346](https://github.com/klauspost/compress/pull/346) + * s2: Fix potential problem with amd64 assembly and profilers [#349](https://github.com/klauspost/compress/pull/349) +
+ +
+ See changes to v1.11.x + +* Mar 26, 2021 (v1.11.13) + * zstd: Big speedup on small dictionary encodes [#344](https://github.com/klauspost/compress/pull/344) [#345](https://github.com/klauspost/compress/pull/345) + * zstd: Add [WithLowerEncoderMem](https://pkg.go.dev/github.com/klauspost/compress/zstd#WithLowerEncoderMem) encoder option [#336](https://github.com/klauspost/compress/pull/336) + * deflate: Improve entropy compression [#338](https://github.com/klauspost/compress/pull/338) + * s2: Clean up and minor performance improvement in best [#341](https://github.com/klauspost/compress/pull/341) + +* Mar 5, 2021 (v1.11.12) + * s2: Add `s2sx` binary that creates [self extracting archives](https://github.com/klauspost/compress/tree/master/s2#s2sx-self-extracting-archives). + * s2: Speed up decompression on non-assembly platforms [#328](https://github.com/klauspost/compress/pull/328) + +* Mar 1, 2021 (v1.11.9) + * s2: Add ARM64 decompression assembly. Around 2x output speed. [#324](https://github.com/klauspost/compress/pull/324) + * s2: Improve "better" speed and efficiency. [#325](https://github.com/klauspost/compress/pull/325) + * s2: Fix binaries. + +* Feb 25, 2021 (v1.11.8) + * s2: Fixed occational out-of-bounds write on amd64. Upgrade recommended. + * s2: Add AMD64 assembly for better mode. 25-50% faster. [#315](https://github.com/klauspost/compress/pull/315) + * s2: Less upfront decoder allocation. [#322](https://github.com/klauspost/compress/pull/322) + * zstd: Faster "compression" of incompressible data. [#314](https://github.com/klauspost/compress/pull/314) + * zip: Fix zip64 headers. [#313](https://github.com/klauspost/compress/pull/313) + +* Jan 14, 2021 (v1.11.7) + * Use Bytes() interface to get bytes across packages. [#309](https://github.com/klauspost/compress/pull/309) + * s2: Add 'best' compression option. [#310](https://github.com/klauspost/compress/pull/310) + * s2: Add ReaderMaxBlockSize, changes `s2.NewReader` signature to include varargs. [#311](https://github.com/klauspost/compress/pull/311) + * s2: Fix crash on small better buffers. [#308](https://github.com/klauspost/compress/pull/308) + * s2: Clean up decoder. [#312](https://github.com/klauspost/compress/pull/312) + +* Jan 7, 2021 (v1.11.6) + * zstd: Make decoder allocations smaller [#306](https://github.com/klauspost/compress/pull/306) + * zstd: Free Decoder resources when Reset is called with a nil io.Reader [#305](https://github.com/klauspost/compress/pull/305) + +* Dec 20, 2020 (v1.11.4) + * zstd: Add Best compression mode [#304](https://github.com/klauspost/compress/pull/304) + * Add header decoder [#299](https://github.com/klauspost/compress/pull/299) + * s2: Add uncompressed stream option [#297](https://github.com/klauspost/compress/pull/297) + * Simplify/speed up small blocks with known max size. [#300](https://github.com/klauspost/compress/pull/300) + * zstd: Always reset literal dict encoder [#303](https://github.com/klauspost/compress/pull/303) + +* Nov 15, 2020 (v1.11.3) + * inflate: 10-15% faster decompression [#293](https://github.com/klauspost/compress/pull/293) + * zstd: Tweak DecodeAll default allocation [#295](https://github.com/klauspost/compress/pull/295) + +* Oct 11, 2020 (v1.11.2) + * s2: Fix out of bounds read in "better" block compression [#291](https://github.com/klauspost/compress/pull/291) + +* Oct 1, 2020 (v1.11.1) + * zstd: Set allLitEntropy true in default configuration [#286](https://github.com/klauspost/compress/pull/286) + +* Sept 8, 2020 (v1.11.0) + * zstd: Add experimental compression [dictionaries](https://github.com/klauspost/compress/tree/master/zstd#dictionaries) [#281](https://github.com/klauspost/compress/pull/281) + * zstd: Fix mixed Write and ReadFrom calls [#282](https://github.com/klauspost/compress/pull/282) + * inflate/gz: Limit variable shifts, ~5% faster decompression [#274](https://github.com/klauspost/compress/pull/274) +
+ +
+ See changes to v1.10.x + +* July 8, 2020 (v1.10.11) + * zstd: Fix extra block when compressing with ReadFrom. [#278](https://github.com/klauspost/compress/pull/278) + * huff0: Also populate compression table when reading decoding table. [#275](https://github.com/klauspost/compress/pull/275) + +* June 23, 2020 (v1.10.10) + * zstd: Skip entropy compression in fastest mode when no matches. [#270](https://github.com/klauspost/compress/pull/270) + +* June 16, 2020 (v1.10.9): + * zstd: API change for specifying dictionaries. See [#268](https://github.com/klauspost/compress/pull/268) + * zip: update CreateHeaderRaw to handle zip64 fields. [#266](https://github.com/klauspost/compress/pull/266) + * Fuzzit tests removed. The service has been purchased and is no longer available. + +* June 5, 2020 (v1.10.8): + * 1.15x faster zstd block decompression. [#265](https://github.com/klauspost/compress/pull/265) + +* June 1, 2020 (v1.10.7): + * Added zstd decompression [dictionary support](https://github.com/klauspost/compress/tree/master/zstd#dictionaries) + * Increase zstd decompression speed up to 1.19x. [#259](https://github.com/klauspost/compress/pull/259) + * Remove internal reset call in zstd compression and reduce allocations. [#263](https://github.com/klauspost/compress/pull/263) + +* May 21, 2020: (v1.10.6) + * zstd: Reduce allocations while decoding. [#258](https://github.com/klauspost/compress/pull/258), [#252](https://github.com/klauspost/compress/pull/252) + * zstd: Stricter decompression checks. + +* April 12, 2020: (v1.10.5) + * s2-commands: Flush output when receiving SIGINT. [#239](https://github.com/klauspost/compress/pull/239) + +* Apr 8, 2020: (v1.10.4) + * zstd: Minor/special case optimizations. [#251](https://github.com/klauspost/compress/pull/251), [#250](https://github.com/klauspost/compress/pull/250), [#249](https://github.com/klauspost/compress/pull/249), [#247](https://github.com/klauspost/compress/pull/247) +* Mar 11, 2020: (v1.10.3) + * s2: Use S2 encoder in pure Go mode for Snappy output as well. [#245](https://github.com/klauspost/compress/pull/245) + * s2: Fix pure Go block encoder. [#244](https://github.com/klauspost/compress/pull/244) + * zstd: Added "better compression" mode. [#240](https://github.com/klauspost/compress/pull/240) + * zstd: Improve speed of fastest compression mode by 5-10% [#241](https://github.com/klauspost/compress/pull/241) + * zstd: Skip creating encoders when not needed. [#238](https://github.com/klauspost/compress/pull/238) + +* Feb 27, 2020: (v1.10.2) + * Close to 50% speedup in inflate (gzip/zip decompression). [#236](https://github.com/klauspost/compress/pull/236) [#234](https://github.com/klauspost/compress/pull/234) [#232](https://github.com/klauspost/compress/pull/232) + * Reduce deflate level 1-6 memory usage up to 59%. [#227](https://github.com/klauspost/compress/pull/227) + +* Feb 18, 2020: (v1.10.1) + * Fix zstd crash when resetting multiple times without sending data. [#226](https://github.com/klauspost/compress/pull/226) + * deflate: Fix dictionary use on level 1-6. [#224](https://github.com/klauspost/compress/pull/224) + * Remove deflate writer reference when closing. [#224](https://github.com/klauspost/compress/pull/224) + +* Feb 4, 2020: (v1.10.0) + * Add optional dictionary to [stateless deflate](https://pkg.go.dev/github.com/klauspost/compress/flate?tab=doc#StatelessDeflate). Breaking change, send `nil` for previous behaviour. [#216](https://github.com/klauspost/compress/pull/216) + * Fix buffer overflow on repeated small block deflate. [#218](https://github.com/klauspost/compress/pull/218) + * Allow copying content from an existing ZIP file without decompressing+compressing. [#214](https://github.com/klauspost/compress/pull/214) + * Added [S2](https://github.com/klauspost/compress/tree/master/s2#s2-compression) AMD64 assembler and various optimizations. Stream speed >10GB/s. [#186](https://github.com/klauspost/compress/pull/186) + +
+ +
+ See changes prior to v1.10.0 + +* Jan 20,2020 (v1.9.8) Optimize gzip/deflate with better size estimates and faster table generation. [#207](https://github.com/klauspost/compress/pull/207) by [luyu6056](https://github.com/luyu6056), [#206](https://github.com/klauspost/compress/pull/206). +* Jan 11, 2020: S2 Encode/Decode will use provided buffer if capacity is big enough. [#204](https://github.com/klauspost/compress/pull/204) +* Jan 5, 2020: (v1.9.7) Fix another zstd regression in v1.9.5 - v1.9.6 removed. +* Jan 4, 2020: (v1.9.6) Regression in v1.9.5 fixed causing corrupt zstd encodes in rare cases. +* Jan 4, 2020: Faster IO in [s2c + s2d commandline tools](https://github.com/klauspost/compress/tree/master/s2#commandline-tools) compression/decompression. [#192](https://github.com/klauspost/compress/pull/192) +* Dec 29, 2019: Removed v1.9.5 since fuzz tests showed a compatibility problem with the reference zstandard decoder. +* Dec 29, 2019: (v1.9.5) zstd: 10-20% faster block compression. [#199](https://github.com/klauspost/compress/pull/199) +* Dec 29, 2019: [zip](https://godoc.org/github.com/klauspost/compress/zip) package updated with latest Go features +* Dec 29, 2019: zstd: Single segment flag condintions tweaked. [#197](https://github.com/klauspost/compress/pull/197) +* Dec 18, 2019: s2: Faster compression when ReadFrom is used. [#198](https://github.com/klauspost/compress/pull/198) +* Dec 10, 2019: s2: Fix repeat length output when just above at 16MB limit. +* Dec 10, 2019: zstd: Add function to get decoder as io.ReadCloser. [#191](https://github.com/klauspost/compress/pull/191) +* Dec 3, 2019: (v1.9.4) S2: limit max repeat length. [#188](https://github.com/klauspost/compress/pull/188) +* Dec 3, 2019: Add [WithNoEntropyCompression](https://godoc.org/github.com/klauspost/compress/zstd#WithNoEntropyCompression) to zstd [#187](https://github.com/klauspost/compress/pull/187) +* Dec 3, 2019: Reduce memory use for tests. Check for leaked goroutines. +* Nov 28, 2019 (v1.9.3) Less allocations in stateless deflate. +* Nov 28, 2019: 5-20% Faster huff0 decode. Impacts zstd as well. [#184](https://github.com/klauspost/compress/pull/184) +* Nov 12, 2019 (v1.9.2) Added [Stateless Compression](#stateless-compression) for gzip/deflate. +* Nov 12, 2019: Fixed zstd decompression of large single blocks. [#180](https://github.com/klauspost/compress/pull/180) +* Nov 11, 2019: Set default [s2c](https://github.com/klauspost/compress/tree/master/s2#commandline-tools) block size to 4MB. +* Nov 11, 2019: Reduce inflate memory use by 1KB. +* Nov 10, 2019: Less allocations in deflate bit writer. +* Nov 10, 2019: Fix inconsistent error returned by zstd decoder. +* Oct 28, 2019 (v1.9.1) ztsd: Fix crash when compressing blocks. [#174](https://github.com/klauspost/compress/pull/174) +* Oct 24, 2019 (v1.9.0) zstd: Fix rare data corruption [#173](https://github.com/klauspost/compress/pull/173) +* Oct 24, 2019 zstd: Fix huff0 out of buffer write [#171](https://github.com/klauspost/compress/pull/171) and always return errors [#172](https://github.com/klauspost/compress/pull/172) +* Oct 10, 2019: Big deflate rewrite, 30-40% faster with better compression [#105](https://github.com/klauspost/compress/pull/105) + +
+ +
+ See changes prior to v1.9.0 + +* Oct 10, 2019: (v1.8.6) zstd: Allow partial reads to get flushed data. [#169](https://github.com/klauspost/compress/pull/169) +* Oct 3, 2019: Fix inconsistent results on broken zstd streams. +* Sep 25, 2019: Added `-rm` (remove source files) and `-q` (no output except errors) to `s2c` and `s2d` [commands](https://github.com/klauspost/compress/tree/master/s2#commandline-tools) +* Sep 16, 2019: (v1.8.4) Add `s2c` and `s2d` [commandline tools](https://github.com/klauspost/compress/tree/master/s2#commandline-tools). +* Sep 10, 2019: (v1.8.3) Fix s2 decoder [Skip](https://godoc.org/github.com/klauspost/compress/s2#Reader.Skip). +* Sep 7, 2019: zstd: Added [WithWindowSize](https://godoc.org/github.com/klauspost/compress/zstd#WithWindowSize), contributed by [ianwilkes](https://github.com/ianwilkes). +* Sep 5, 2019: (v1.8.2) Add [WithZeroFrames](https://godoc.org/github.com/klauspost/compress/zstd#WithZeroFrames) which adds full zero payload block encoding option. +* Sep 5, 2019: Lazy initialization of zstandard predefined en/decoder tables. +* Aug 26, 2019: (v1.8.1) S2: 1-2% compression increase in "better" compression mode. +* Aug 26, 2019: zstd: Check maximum size of Huffman 1X compressed literals while decoding. +* Aug 24, 2019: (v1.8.0) Added [S2 compression](https://github.com/klauspost/compress/tree/master/s2#s2-compression), a high performance replacement for Snappy. +* Aug 21, 2019: (v1.7.6) Fixed minor issues found by fuzzer. One could lead to zstd not decompressing. +* Aug 18, 2019: Add [fuzzit](https://fuzzit.dev/) continuous fuzzing. +* Aug 14, 2019: zstd: Skip incompressible data 2x faster. [#147](https://github.com/klauspost/compress/pull/147) +* Aug 4, 2019 (v1.7.5): Better literal compression. [#146](https://github.com/klauspost/compress/pull/146) +* Aug 4, 2019: Faster zstd compression. [#143](https://github.com/klauspost/compress/pull/143) [#144](https://github.com/klauspost/compress/pull/144) +* Aug 4, 2019: Faster zstd decompression. [#145](https://github.com/klauspost/compress/pull/145) [#143](https://github.com/klauspost/compress/pull/143) [#142](https://github.com/klauspost/compress/pull/142) +* July 15, 2019 (v1.7.4): Fix double EOF block in rare cases on zstd encoder. +* July 15, 2019 (v1.7.3): Minor speedup/compression increase in default zstd encoder. +* July 14, 2019: zstd decoder: Fix decompression error on multiple uses with mixed content. +* July 7, 2019 (v1.7.2): Snappy update, zstd decoder potential race fix. +* June 17, 2019: zstd decompression bugfix. +* June 17, 2019: fix 32 bit builds. +* June 17, 2019: Easier use in modules (less dependencies). +* June 9, 2019: New stronger "default" [zstd](https://github.com/klauspost/compress/tree/master/zstd#zstd) compression mode. Matches zstd default compression ratio. +* June 5, 2019: 20-40% throughput in [zstandard](https://github.com/klauspost/compress/tree/master/zstd#zstd) compression and better compression. +* June 5, 2019: deflate/gzip compression: Reduce memory usage of lower compression levels. +* June 2, 2019: Added [zstandard](https://github.com/klauspost/compress/tree/master/zstd#zstd) compression! +* May 25, 2019: deflate/gzip: 10% faster bit writer, mostly visible in lower levels. +* Apr 22, 2019: [zstd](https://github.com/klauspost/compress/tree/master/zstd#zstd) decompression added. +* Aug 1, 2018: Added [huff0 README](https://github.com/klauspost/compress/tree/master/huff0#huff0-entropy-compression). +* Jul 8, 2018: Added [Performance Update 2018](#performance-update-2018) below. +* Jun 23, 2018: Merged [Go 1.11 inflate optimizations](https://go-review.googlesource.com/c/go/+/102235). Go 1.9 is now required. Backwards compatible version tagged with [v1.3.0](https://github.com/klauspost/compress/releases/tag/v1.3.0). +* Apr 2, 2018: Added [huff0](https://godoc.org/github.com/klauspost/compress/huff0) en/decoder. Experimental for now, API may change. +* Mar 4, 2018: Added [FSE Entropy](https://godoc.org/github.com/klauspost/compress/fse) en/decoder. Experimental for now, API may change. +* Nov 3, 2017: Add compression [Estimate](https://godoc.org/github.com/klauspost/compress#Estimate) function. +* May 28, 2017: Reduce allocations when resetting decoder. +* Apr 02, 2017: Change back to official crc32, since changes were merged in Go 1.7. +* Jan 14, 2017: Reduce stack pressure due to array copies. See [Issue #18625](https://github.com/golang/go/issues/18625). +* Oct 25, 2016: Level 2-4 have been rewritten and now offers significantly better performance than before. +* Oct 20, 2016: Port zlib changes from Go 1.7 to fix zlib writer issue. Please update. +* Oct 16, 2016: Go 1.7 changes merged. Apples to apples this package is a few percent faster, but has a significantly better balance between speed and compression per level. +* Mar 24, 2016: Always attempt Huffman encoding on level 4-7. This improves base 64 encoded data compression. +* Mar 24, 2016: Small speedup for level 1-3. +* Feb 19, 2016: Faster bit writer, level -2 is 15% faster, level 1 is 4% faster. +* Feb 19, 2016: Handle small payloads faster in level 1-3. +* Feb 19, 2016: Added faster level 2 + 3 compression modes. +* Feb 19, 2016: [Rebalanced compression levels](https://blog.klauspost.com/rebalancing-deflate-compression-levels/), so there is a more even progresssion in terms of compression. New default level is 5. +* Feb 14, 2016: Snappy: Merge upstream changes. +* Feb 14, 2016: Snappy: Fix aggressive skipping. +* Feb 14, 2016: Snappy: Update benchmark. +* Feb 13, 2016: Deflate: Fixed assembler problem that could lead to sub-optimal compression. +* Feb 12, 2016: Snappy: Added AMD64 SSE 4.2 optimizations to matching, which makes easy to compress material run faster. Typical speedup is around 25%. +* Feb 9, 2016: Added Snappy package fork. This version is 5-7% faster, much more on hard to compress content. +* Jan 30, 2016: Optimize level 1 to 3 by not considering static dictionary or storing uncompressed. ~4-5% speedup. +* Jan 16, 2016: Optimization on deflate level 1,2,3 compression. +* Jan 8 2016: Merge [CL 18317](https://go-review.googlesource.com/#/c/18317): fix reading, writing of zip64 archives. +* Dec 8 2015: Make level 1 and -2 deterministic even if write size differs. +* Dec 8 2015: Split encoding functions, so hashing and matching can potentially be inlined. 1-3% faster on AMD64. 5% faster on other platforms. +* Dec 8 2015: Fixed rare [one byte out-of bounds read](https://github.com/klauspost/compress/issues/20). Please update! +* Nov 23 2015: Optimization on token writer. ~2-4% faster. Contributed by [@dsnet](https://github.com/dsnet). +* Nov 20 2015: Small optimization to bit writer on 64 bit systems. +* Nov 17 2015: Fixed out-of-bound errors if the underlying Writer returned an error. See [#15](https://github.com/klauspost/compress/issues/15). +* Nov 12 2015: Added [io.WriterTo](https://golang.org/pkg/io/#WriterTo) support to gzip/inflate. +* Nov 11 2015: Merged [CL 16669](https://go-review.googlesource.com/#/c/16669/4): archive/zip: enable overriding (de)compressors per file +* Oct 15 2015: Added skipping on uncompressible data. Random data speed up >5x. + +
+ +# deflate usage + +The packages are drop-in replacements for standard libraries. Simply replace the import path to use them: + +| old import | new import | Documentation +|--------------------|-----------------------------------------|--------------------| +| `compress/gzip` | `github.com/klauspost/compress/gzip` | [gzip](https://pkg.go.dev/github.com/klauspost/compress/gzip?tab=doc) +| `compress/zlib` | `github.com/klauspost/compress/zlib` | [zlib](https://pkg.go.dev/github.com/klauspost/compress/zlib?tab=doc) +| `archive/zip` | `github.com/klauspost/compress/zip` | [zip](https://pkg.go.dev/github.com/klauspost/compress/zip?tab=doc) +| `compress/flate` | `github.com/klauspost/compress/flate` | [flate](https://pkg.go.dev/github.com/klauspost/compress/flate?tab=doc) + +* Optimized [deflate](https://godoc.org/github.com/klauspost/compress/flate) packages which can be used as a dropin replacement for [gzip](https://godoc.org/github.com/klauspost/compress/gzip), [zip](https://godoc.org/github.com/klauspost/compress/zip) and [zlib](https://godoc.org/github.com/klauspost/compress/zlib). + +You may also be interested in [pgzip](https://github.com/klauspost/pgzip), which is a drop in replacement for gzip, which support multithreaded compression on big files and the optimized [crc32](https://github.com/klauspost/crc32) package used by these packages. + +The packages contains the same as the standard library, so you can use the godoc for that: [gzip](http://golang.org/pkg/compress/gzip/), [zip](http://golang.org/pkg/archive/zip/), [zlib](http://golang.org/pkg/compress/zlib/), [flate](http://golang.org/pkg/compress/flate/). + +Currently there is only minor speedup on decompression (mostly CRC32 calculation). + +Memory usage is typically 1MB for a Writer. stdlib is in the same range. +If you expect to have a lot of concurrently allocated Writers consider using +the stateless compress described below. + +For compression performance, see: [this spreadsheet](https://docs.google.com/spreadsheets/d/1nuNE2nPfuINCZJRMt6wFWhKpToF95I47XjSsc-1rbPQ/edit?usp=sharing). + +# Stateless compression + +This package offers stateless compression as a special option for gzip/deflate. +It will do compression but without maintaining any state between Write calls. + +This means there will be no memory kept between Write calls, but compression and speed will be suboptimal. + +This is only relevant in cases where you expect to run many thousands of compressors concurrently, +but with very little activity. This is *not* intended for regular web servers serving individual requests. + +Because of this, the size of actual Write calls will affect output size. + +In gzip, specify level `-3` / `gzip.StatelessCompression` to enable. + +For direct deflate use, NewStatelessWriter and StatelessDeflate are available. See [documentation](https://godoc.org/github.com/klauspost/compress/flate#NewStatelessWriter) + +A `bufio.Writer` can of course be used to control write sizes. For example, to use a 4KB buffer: + +``` + // replace 'ioutil.Discard' with your output. + gzw, err := gzip.NewWriterLevel(ioutil.Discard, gzip.StatelessCompression) + if err != nil { + return err + } + defer gzw.Close() + + w := bufio.NewWriterSize(gzw, 4096) + defer w.Flush() + + // Write to 'w' +``` + +This will only use up to 4KB in memory when the writer is idle. + +Compression is almost always worse than the fastest compression level +and each write will allocate (a little) memory. + +# Performance Update 2018 + +It has been a while since we have been looking at the speed of this package compared to the standard library, so I thought I would re-do my tests and give some overall recommendations based on the current state. All benchmarks have been performed with Go 1.10 on my Desktop Intel(R) Core(TM) i7-2600 CPU @3.40GHz. Since I last ran the tests, I have gotten more RAM, which means tests with big files are no longer limited by my SSD. + +The raw results are in my [updated spreadsheet](https://docs.google.com/spreadsheets/d/1nuNE2nPfuINCZJRMt6wFWhKpToF95I47XjSsc-1rbPQ/edit?usp=sharing). Due to cgo changes and upstream updates i could not get the cgo version of gzip to compile. Instead I included the [zstd](https://github.com/datadog/zstd) cgo implementation. If I get cgo gzip to work again, I might replace the results in the sheet. + +The columns to take note of are: *MB/s* - the throughput. *Reduction* - the data size reduction in percent of the original. *Rel Speed* relative speed compared to the standard library at the same level. *Smaller* - how many percent smaller is the compressed output compared to stdlib. Negative means the output was bigger. *Loss* means the loss (or gain) in compression as a percentage difference of the input. + +The `gzstd` (standard library gzip) and `gzkp` (this package gzip) only uses one CPU core. [`pgzip`](https://github.com/klauspost/pgzip), [`bgzf`](https://github.com/biogo/hts/tree/master/bgzf) uses all 4 cores. [`zstd`](https://github.com/DataDog/zstd) uses one core, and is a beast (but not Go, yet). + + +## Overall differences. + +There appears to be a roughly 5-10% speed advantage over the standard library when comparing at similar compression levels. + +The biggest difference you will see is the result of [re-balancing](https://blog.klauspost.com/rebalancing-deflate-compression-levels/) the compression levels. I wanted by library to give a smoother transition between the compression levels than the standard library. + +This package attempts to provide a more smooth transition, where "1" is taking a lot of shortcuts, "5" is the reasonable trade-off and "9" is the "give me the best compression", and the values in between gives something reasonable in between. The standard library has big differences in levels 1-4, but levels 5-9 having no significant gains - often spending a lot more time than can be justified by the achieved compression. + +There are links to all the test data in the [spreadsheet](https://docs.google.com/spreadsheets/d/1nuNE2nPfuINCZJRMt6wFWhKpToF95I47XjSsc-1rbPQ/edit?usp=sharing) in the top left field on each tab. + +## Web Content + +This test set aims to emulate typical use in a web server. The test-set is 4GB data in 53k files, and is a mixture of (mostly) HTML, JS, CSS. + +Since level 1 and 9 are close to being the same code, they are quite close. But looking at the levels in-between the differences are quite big. + +Looking at level 6, this package is 88% faster, but will output about 6% more data. For a web server, this means you can serve 88% more data, but have to pay for 6% more bandwidth. You can draw your own conclusions on what would be the most expensive for your case. + +## Object files + +This test is for typical data files stored on a server. In this case it is a collection of Go precompiled objects. They are very compressible. + +The picture is similar to the web content, but with small differences since this is very compressible. Levels 2-3 offer good speed, but is sacrificing quite a bit of compression. + +The standard library seems suboptimal on level 3 and 4 - offering both worse compression and speed than level 6 & 7 of this package respectively. + +## Highly Compressible File + +This is a JSON file with very high redundancy. The reduction starts at 95% on level 1, so in real life terms we are dealing with something like a highly redundant stream of data, etc. + +It is definitely visible that we are dealing with specialized content here, so the results are very scattered. This package does not do very well at levels 1-4, but picks up significantly at level 5 and levels 7 and 8 offering great speed for the achieved compression. + +So if you know you content is extremely compressible you might want to go slightly higher than the defaults. The standard library has a huge gap between levels 3 and 4 in terms of speed (2.75x slowdown), so it offers little "middle ground". + +## Medium-High Compressible + +This is a pretty common test corpus: [enwik9](http://mattmahoney.net/dc/textdata.html). It contains the first 10^9 bytes of the English Wikipedia dump on Mar. 3, 2006. This is a very good test of typical text based compression and more data heavy streams. + +We see a similar picture here as in "Web Content". On equal levels some compression is sacrificed for more speed. Level 5 seems to be the best trade-off between speed and size, beating stdlib level 3 in both. + +## Medium Compressible + +I will combine two test sets, one [10GB file set](http://mattmahoney.net/dc/10gb.html) and a VM disk image (~8GB). Both contain different data types and represent a typical backup scenario. + +The most notable thing is how quickly the standard library drops to very low compression speeds around level 5-6 without any big gains in compression. Since this type of data is fairly common, this does not seem like good behavior. + + +## Un-compressible Content + +This is mainly a test of how good the algorithms are at detecting un-compressible input. The standard library only offers this feature with very conservative settings at level 1. Obviously there is no reason for the algorithms to try to compress input that cannot be compressed. The only downside is that it might skip some compressible data on false detections. + + +## Huffman only compression + +This compression library adds a special compression level, named `HuffmanOnly`, which allows near linear time compression. This is done by completely disabling matching of previous data, and only reduce the number of bits to represent each character. + +This means that often used characters, like 'e' and ' ' (space) in text use the fewest bits to represent, and rare characters like '¤' takes more bits to represent. For more information see [wikipedia](https://en.wikipedia.org/wiki/Huffman_coding) or this nice [video](https://youtu.be/ZdooBTdW5bM). + +Since this type of compression has much less variance, the compression speed is mostly unaffected by the input data, and is usually more than *180MB/s* for a single core. + +The downside is that the compression ratio is usually considerably worse than even the fastest conventional compression. The compression ratio can never be better than 8:1 (12.5%). + +The linear time compression can be used as a "better than nothing" mode, where you cannot risk the encoder to slow down on some content. For comparison, the size of the "Twain" text is *233460 bytes* (+29% vs. level 1) and encode speed is 144MB/s (4.5x level 1). So in this case you trade a 30% size increase for a 4 times speedup. + +For more information see my blog post on [Fast Linear Time Compression](http://blog.klauspost.com/constant-time-gzipzip-compression/). + +This is implemented on Go 1.7 as "Huffman Only" mode, though not exposed for gzip. + +# Other packages + +Here are other packages of good quality and pure Go (no cgo wrappers or autoconverted code): + +* [github.com/pierrec/lz4](https://github.com/pierrec/lz4) - strong multithreaded LZ4 compression. +* [github.com/cosnicolaou/pbzip2](https://github.com/cosnicolaou/pbzip2) - multithreaded bzip2 decompression. +* [github.com/dsnet/compress](https://github.com/dsnet/compress) - brotli decompression, bzip2 writer. +* [github.com/ronanh/intcomp](https://github.com/ronanh/intcomp) - Integer compression. +* [github.com/spenczar/fpc](https://github.com/spenczar/fpc) - Float compression. + +# license + +This code is licensed under the same conditions as the original Go code. See LICENSE file. diff --git a/vendor/github.com/klauspost/compress/SECURITY.md b/vendor/github.com/klauspost/compress/SECURITY.md new file mode 100644 index 000000000..ca6685e2b --- /dev/null +++ b/vendor/github.com/klauspost/compress/SECURITY.md @@ -0,0 +1,25 @@ +# Security Policy + +## Supported Versions + +Security updates are applied only to the latest release. + +## Vulnerability Definition + +A security vulnerability is a bug that with certain input triggers a crash or an infinite loop. Most calls will have varying execution time and only in rare cases will slow operation be considered a security vulnerability. + +Corrupted output generally is not considered a security vulnerability, unless independent operations are able to affect each other. Note that not all functionality is re-entrant and safe to use concurrently. + +Out-of-memory crashes only applies if the en/decoder uses an abnormal amount of memory, with appropriate options applied, to limit maximum window size, concurrency, etc. However, if you are in doubt you are welcome to file a security issue. + +It is assumed that all callers are trusted, meaning internal data exposed through reflection or inspection of returned data structures is not considered a vulnerability. + +Vulnerabilities resulting from compiler/assembler errors should be reported upstream. Depending on the severity this package may or may not implement a workaround. + +## Reporting a Vulnerability + +If you have discovered a security vulnerability in this project, please report it privately. **Do not disclose it as a public issue.** This gives us time to work with you to fix the issue before public exposure, reducing the chance that the exploit will be used before a patch is released. + +Please disclose it at [security advisory](https://github.com/klauspost/compress/security/advisories/new). If possible please provide a minimal reproducer. If the issue only applies to a single platform, it would be helpful to provide access to that. + +This project is maintained by a team of volunteers on a reasonable-effort basis. As such, vulnerabilities will be disclosed in a best effort base. diff --git a/vendor/github.com/klauspost/compress/compressible.go b/vendor/github.com/klauspost/compress/compressible.go new file mode 100644 index 000000000..ea5a692d5 --- /dev/null +++ b/vendor/github.com/klauspost/compress/compressible.go @@ -0,0 +1,85 @@ +package compress + +import "math" + +// Estimate returns a normalized compressibility estimate of block b. +// Values close to zero are likely uncompressible. +// Values above 0.1 are likely to be compressible. +// Values above 0.5 are very compressible. +// Very small lengths will return 0. +func Estimate(b []byte) float64 { + if len(b) < 16 { + return 0 + } + + // Correctly predicted order 1 + hits := 0 + lastMatch := false + var o1 [256]byte + var hist [256]int + c1 := byte(0) + for _, c := range b { + if c == o1[c1] { + // We only count a hit if there was two correct predictions in a row. + if lastMatch { + hits++ + } + lastMatch = true + } else { + lastMatch = false + } + o1[c1] = c + c1 = c + hist[c]++ + } + + // Use x^0.6 to give better spread + prediction := math.Pow(float64(hits)/float64(len(b)), 0.6) + + // Calculate histogram distribution + variance := float64(0) + avg := float64(len(b)) / 256 + + for _, v := range hist { + Δ := float64(v) - avg + variance += Δ * Δ + } + + stddev := math.Sqrt(float64(variance)) / float64(len(b)) + exp := math.Sqrt(1 / float64(len(b))) + + // Subtract expected stddev + stddev -= exp + if stddev < 0 { + stddev = 0 + } + stddev *= 1 + exp + + // Use x^0.4 to give better spread + entropy := math.Pow(stddev, 0.4) + + // 50/50 weight between prediction and histogram distribution + return math.Pow((prediction+entropy)/2, 0.9) +} + +// ShannonEntropyBits returns the number of bits minimum required to represent +// an entropy encoding of the input bytes. +// https://en.wiktionary.org/wiki/Shannon_entropy +func ShannonEntropyBits(b []byte) int { + if len(b) == 0 { + return 0 + } + var hist [256]int + for _, c := range b { + hist[c]++ + } + shannon := float64(0) + invTotal := 1.0 / float64(len(b)) + for _, v := range hist[:] { + if v > 0 { + n := float64(v) + shannon += math.Ceil(-math.Log2(n*invTotal) * n) + } + } + return int(math.Ceil(shannon)) +} diff --git a/vendor/github.com/klauspost/compress/fse/README.md b/vendor/github.com/klauspost/compress/fse/README.md new file mode 100644 index 000000000..ea7324da6 --- /dev/null +++ b/vendor/github.com/klauspost/compress/fse/README.md @@ -0,0 +1,79 @@ +# Finite State Entropy + +This package provides Finite State Entropy encoding and decoding. + +Finite State Entropy (also referenced as [tANS](https://en.wikipedia.org/wiki/Asymmetric_numeral_systems#tANS)) +encoding provides a fast near-optimal symbol encoding/decoding +for byte blocks as implemented in [zstandard](https://github.com/facebook/zstd). + +This can be used for compressing input with a lot of similar input values to the smallest number of bytes. +This does not perform any multi-byte [dictionary coding](https://en.wikipedia.org/wiki/Dictionary_coder) as LZ coders, +but it can be used as a secondary step to compressors (like Snappy) that does not do entropy encoding. + +* [Godoc documentation](https://godoc.org/github.com/klauspost/compress/fse) + +## News + + * Feb 2018: First implementation released. Consider this beta software for now. + +# Usage + +This package provides a low level interface that allows to compress single independent blocks. + +Each block is separate, and there is no built in integrity checks. +This means that the caller should keep track of block sizes and also do checksums if needed. + +Compressing a block is done via the [`Compress`](https://godoc.org/github.com/klauspost/compress/fse#Compress) function. +You must provide input and will receive the output and maybe an error. + +These error values can be returned: + +| Error | Description | +|---------------------|-----------------------------------------------------------------------------| +| `` | Everything ok, output is returned | +| `ErrIncompressible` | Returned when input is judged to be too hard to compress | +| `ErrUseRLE` | Returned from the compressor when the input is a single byte value repeated | +| `(error)` | An internal error occurred. | + +As can be seen above there are errors that will be returned even under normal operation so it is important to handle these. + +To reduce allocations you can provide a [`Scratch`](https://godoc.org/github.com/klauspost/compress/fse#Scratch) object +that can be re-used for successive calls. Both compression and decompression accepts a `Scratch` object, and the same +object can be used for both. + +Be aware, that when re-using a `Scratch` object that the *output* buffer is also re-used, so if you are still using this +you must set the `Out` field in the scratch to nil. The same buffer is used for compression and decompression output. + +Decompressing is done by calling the [`Decompress`](https://godoc.org/github.com/klauspost/compress/fse#Decompress) function. +You must provide the output from the compression stage, at exactly the size you got back. If you receive an error back +your input was likely corrupted. + +It is important to note that a successful decoding does *not* mean your output matches your original input. +There are no integrity checks, so relying on errors from the decompressor does not assure your data is valid. + +For more detailed usage, see examples in the [godoc documentation](https://godoc.org/github.com/klauspost/compress/fse#pkg-examples). + +# Performance + +A lot of factors are affecting speed. Block sizes and compressibility of the material are primary factors. +All compression functions are currently only running on the calling goroutine so only one core will be used per block. + +The compressor is significantly faster if symbols are kept as small as possible. The highest byte value of the input +is used to reduce some of the processing, so if all your input is above byte value 64 for instance, it may be +beneficial to transpose all your input values down by 64. + +With moderate block sizes around 64k speed are typically 200MB/s per core for compression and +around 300MB/s decompression speed. + +The same hardware typically does Huffman (deflate) encoding at 125MB/s and decompression at 100MB/s. + +# Plans + +At one point, more internals will be exposed to facilitate more "expert" usage of the components. + +A streaming interface is also likely to be implemented. Likely compatible with [FSE stream format](https://github.com/Cyan4973/FiniteStateEntropy/blob/dev/programs/fileio.c#L261). + +# Contributing + +Contributions are always welcome. Be aware that adding public functions will require good justification and breaking +changes will likely not be accepted. If in doubt open an issue before writing the PR. \ No newline at end of file diff --git a/vendor/github.com/klauspost/compress/fse/bitreader.go b/vendor/github.com/klauspost/compress/fse/bitreader.go new file mode 100644 index 000000000..f65eb3909 --- /dev/null +++ b/vendor/github.com/klauspost/compress/fse/bitreader.go @@ -0,0 +1,122 @@ +// Copyright 2018 Klaus Post. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. +// Based on work Copyright (c) 2013, Yann Collet, released under BSD License. + +package fse + +import ( + "encoding/binary" + "errors" + "io" +) + +// bitReader reads a bitstream in reverse. +// The last set bit indicates the start of the stream and is used +// for aligning the input. +type bitReader struct { + in []byte + off uint // next byte to read is at in[off - 1] + value uint64 + bitsRead uint8 +} + +// init initializes and resets the bit reader. +func (b *bitReader) init(in []byte) error { + if len(in) < 1 { + return errors.New("corrupt stream: too short") + } + b.in = in + b.off = uint(len(in)) + // The highest bit of the last byte indicates where to start + v := in[len(in)-1] + if v == 0 { + return errors.New("corrupt stream, did not find end of stream") + } + b.bitsRead = 64 + b.value = 0 + if len(in) >= 8 { + b.fillFastStart() + } else { + b.fill() + b.fill() + } + b.bitsRead += 8 - uint8(highBits(uint32(v))) + return nil +} + +// getBits will return n bits. n can be 0. +func (b *bitReader) getBits(n uint8) uint16 { + if n == 0 || b.bitsRead >= 64 { + return 0 + } + return b.getBitsFast(n) +} + +// getBitsFast requires that at least one bit is requested every time. +// There are no checks if the buffer is filled. +func (b *bitReader) getBitsFast(n uint8) uint16 { + const regMask = 64 - 1 + v := uint16((b.value << (b.bitsRead & regMask)) >> ((regMask + 1 - n) & regMask)) + b.bitsRead += n + return v +} + +// fillFast() will make sure at least 32 bits are available. +// There must be at least 4 bytes available. +func (b *bitReader) fillFast() { + if b.bitsRead < 32 { + return + } + // 2 bounds checks. + v := b.in[b.off-4:] + v = v[:4] + low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + b.value = (b.value << 32) | uint64(low) + b.bitsRead -= 32 + b.off -= 4 +} + +// fill() will make sure at least 32 bits are available. +func (b *bitReader) fill() { + if b.bitsRead < 32 { + return + } + if b.off > 4 { + v := b.in[b.off-4:] + v = v[:4] + low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + b.value = (b.value << 32) | uint64(low) + b.bitsRead -= 32 + b.off -= 4 + return + } + for b.off > 0 { + b.value = (b.value << 8) | uint64(b.in[b.off-1]) + b.bitsRead -= 8 + b.off-- + } +} + +// fillFastStart() assumes the bitreader is empty and there is at least 8 bytes to read. +func (b *bitReader) fillFastStart() { + // Do single re-slice to avoid bounds checks. + b.value = binary.LittleEndian.Uint64(b.in[b.off-8:]) + b.bitsRead = 0 + b.off -= 8 +} + +// finished returns true if all bits have been read from the bit stream. +func (b *bitReader) finished() bool { + return b.bitsRead >= 64 && b.off == 0 +} + +// close the bitstream and returns an error if out-of-buffer reads occurred. +func (b *bitReader) close() error { + // Release reference. + b.in = nil + if b.bitsRead > 64 { + return io.ErrUnexpectedEOF + } + return nil +} diff --git a/vendor/github.com/klauspost/compress/fse/bitwriter.go b/vendor/github.com/klauspost/compress/fse/bitwriter.go new file mode 100644 index 000000000..43e463611 --- /dev/null +++ b/vendor/github.com/klauspost/compress/fse/bitwriter.go @@ -0,0 +1,168 @@ +// Copyright 2018 Klaus Post. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. +// Based on work Copyright (c) 2013, Yann Collet, released under BSD License. + +package fse + +import "fmt" + +// bitWriter will write bits. +// First bit will be LSB of the first byte of output. +type bitWriter struct { + bitContainer uint64 + nBits uint8 + out []byte +} + +// bitMask16 is bitmasks. Has extra to avoid bounds check. +var bitMask16 = [32]uint16{ + 0, 1, 3, 7, 0xF, 0x1F, + 0x3F, 0x7F, 0xFF, 0x1FF, 0x3FF, 0x7FF, + 0xFFF, 0x1FFF, 0x3FFF, 0x7FFF, 0xFFFF, 0xFFFF, + 0xFFFF, 0xFFFF, 0xFFFF, 0xFFFF, 0xFFFF, 0xFFFF, + 0xFFFF, 0xFFFF} /* up to 16 bits */ + +// addBits16NC will add up to 16 bits. +// It will not check if there is space for them, +// so the caller must ensure that it has flushed recently. +func (b *bitWriter) addBits16NC(value uint16, bits uint8) { + b.bitContainer |= uint64(value&bitMask16[bits&31]) << (b.nBits & 63) + b.nBits += bits +} + +// addBits16Clean will add up to 16 bits. value may not contain more set bits than indicated. +// It will not check if there is space for them, so the caller must ensure that it has flushed recently. +func (b *bitWriter) addBits16Clean(value uint16, bits uint8) { + b.bitContainer |= uint64(value) << (b.nBits & 63) + b.nBits += bits +} + +// addBits16ZeroNC will add up to 16 bits. +// It will not check if there is space for them, +// so the caller must ensure that it has flushed recently. +// This is fastest if bits can be zero. +func (b *bitWriter) addBits16ZeroNC(value uint16, bits uint8) { + if bits == 0 { + return + } + value <<= (16 - bits) & 15 + value >>= (16 - bits) & 15 + b.bitContainer |= uint64(value) << (b.nBits & 63) + b.nBits += bits +} + +// flush will flush all pending full bytes. +// There will be at least 56 bits available for writing when this has been called. +// Using flush32 is faster, but leaves less space for writing. +func (b *bitWriter) flush() { + v := b.nBits >> 3 + switch v { + case 0: + case 1: + b.out = append(b.out, + byte(b.bitContainer), + ) + case 2: + b.out = append(b.out, + byte(b.bitContainer), + byte(b.bitContainer>>8), + ) + case 3: + b.out = append(b.out, + byte(b.bitContainer), + byte(b.bitContainer>>8), + byte(b.bitContainer>>16), + ) + case 4: + b.out = append(b.out, + byte(b.bitContainer), + byte(b.bitContainer>>8), + byte(b.bitContainer>>16), + byte(b.bitContainer>>24), + ) + case 5: + b.out = append(b.out, + byte(b.bitContainer), + byte(b.bitContainer>>8), + byte(b.bitContainer>>16), + byte(b.bitContainer>>24), + byte(b.bitContainer>>32), + ) + case 6: + b.out = append(b.out, + byte(b.bitContainer), + byte(b.bitContainer>>8), + byte(b.bitContainer>>16), + byte(b.bitContainer>>24), + byte(b.bitContainer>>32), + byte(b.bitContainer>>40), + ) + case 7: + b.out = append(b.out, + byte(b.bitContainer), + byte(b.bitContainer>>8), + byte(b.bitContainer>>16), + byte(b.bitContainer>>24), + byte(b.bitContainer>>32), + byte(b.bitContainer>>40), + byte(b.bitContainer>>48), + ) + case 8: + b.out = append(b.out, + byte(b.bitContainer), + byte(b.bitContainer>>8), + byte(b.bitContainer>>16), + byte(b.bitContainer>>24), + byte(b.bitContainer>>32), + byte(b.bitContainer>>40), + byte(b.bitContainer>>48), + byte(b.bitContainer>>56), + ) + default: + panic(fmt.Errorf("bits (%d) > 64", b.nBits)) + } + b.bitContainer >>= v << 3 + b.nBits &= 7 +} + +// flush32 will flush out, so there are at least 32 bits available for writing. +func (b *bitWriter) flush32() { + if b.nBits < 32 { + return + } + b.out = append(b.out, + byte(b.bitContainer), + byte(b.bitContainer>>8), + byte(b.bitContainer>>16), + byte(b.bitContainer>>24)) + b.nBits -= 32 + b.bitContainer >>= 32 +} + +// flushAlign will flush remaining full bytes and align to next byte boundary. +func (b *bitWriter) flushAlign() { + nbBytes := (b.nBits + 7) >> 3 + for i := uint8(0); i < nbBytes; i++ { + b.out = append(b.out, byte(b.bitContainer>>(i*8))) + } + b.nBits = 0 + b.bitContainer = 0 +} + +// close will write the alignment bit and write the final byte(s) +// to the output. +func (b *bitWriter) close() error { + // End mark + b.addBits16Clean(1, 1) + // flush until next byte. + b.flushAlign() + return nil +} + +// reset and continue writing by appending to out. +func (b *bitWriter) reset(out []byte) { + b.bitContainer = 0 + b.nBits = 0 + b.out = out +} diff --git a/vendor/github.com/klauspost/compress/fse/bytereader.go b/vendor/github.com/klauspost/compress/fse/bytereader.go new file mode 100644 index 000000000..abade2d60 --- /dev/null +++ b/vendor/github.com/klauspost/compress/fse/bytereader.go @@ -0,0 +1,47 @@ +// Copyright 2018 Klaus Post. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. +// Based on work Copyright (c) 2013, Yann Collet, released under BSD License. + +package fse + +// byteReader provides a byte reader that reads +// little endian values from a byte stream. +// The input stream is manually advanced. +// The reader performs no bounds checks. +type byteReader struct { + b []byte + off int +} + +// init will initialize the reader and set the input. +func (b *byteReader) init(in []byte) { + b.b = in + b.off = 0 +} + +// advance the stream b n bytes. +func (b *byteReader) advance(n uint) { + b.off += int(n) +} + +// Uint32 returns a little endian uint32 starting at current offset. +func (b byteReader) Uint32() uint32 { + b2 := b.b[b.off:] + b2 = b2[:4] + v3 := uint32(b2[3]) + v2 := uint32(b2[2]) + v1 := uint32(b2[1]) + v0 := uint32(b2[0]) + return v0 | (v1 << 8) | (v2 << 16) | (v3 << 24) +} + +// unread returns the unread portion of the input. +func (b byteReader) unread() []byte { + return b.b[b.off:] +} + +// remain will return the number of bytes remaining. +func (b byteReader) remain() int { + return len(b.b) - b.off +} diff --git a/vendor/github.com/klauspost/compress/fse/compress.go b/vendor/github.com/klauspost/compress/fse/compress.go new file mode 100644 index 000000000..dac97e58a --- /dev/null +++ b/vendor/github.com/klauspost/compress/fse/compress.go @@ -0,0 +1,682 @@ +// Copyright 2018 Klaus Post. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. +// Based on work Copyright (c) 2013, Yann Collet, released under BSD License. + +package fse + +import ( + "errors" + "fmt" +) + +// Compress the input bytes. Input must be < 2GB. +// Provide a Scratch buffer to avoid memory allocations. +// Note that the output is also kept in the scratch buffer. +// If input is too hard to compress, ErrIncompressible is returned. +// If input is a single byte value repeated ErrUseRLE is returned. +func Compress(in []byte, s *Scratch) ([]byte, error) { + if len(in) <= 1 { + return nil, ErrIncompressible + } + if len(in) > (2<<30)-1 { + return nil, errors.New("input too big, must be < 2GB") + } + s, err := s.prepare(in) + if err != nil { + return nil, err + } + + // Create histogram, if none was provided. + maxCount := s.maxCount + if maxCount == 0 { + maxCount = s.countSimple(in) + } + // Reset for next run. + s.clearCount = true + s.maxCount = 0 + if maxCount == len(in) { + // One symbol, use RLE + return nil, ErrUseRLE + } + if maxCount == 1 || maxCount < (len(in)>>7) { + // Each symbol present maximum once or too well distributed. + return nil, ErrIncompressible + } + s.optimalTableLog() + err = s.normalizeCount() + if err != nil { + return nil, err + } + err = s.writeCount() + if err != nil { + return nil, err + } + + if false { + err = s.validateNorm() + if err != nil { + return nil, err + } + } + + err = s.buildCTable() + if err != nil { + return nil, err + } + err = s.compress(in) + if err != nil { + return nil, err + } + s.Out = s.bw.out + // Check if we compressed. + if len(s.Out) >= len(in) { + return nil, ErrIncompressible + } + return s.Out, nil +} + +// cState contains the compression state of a stream. +type cState struct { + bw *bitWriter + stateTable []uint16 + state uint16 +} + +// init will initialize the compression state to the first symbol of the stream. +func (c *cState) init(bw *bitWriter, ct *cTable, tableLog uint8, first symbolTransform) { + c.bw = bw + c.stateTable = ct.stateTable + + nbBitsOut := (first.deltaNbBits + (1 << 15)) >> 16 + im := int32((nbBitsOut << 16) - first.deltaNbBits) + lu := (im >> nbBitsOut) + first.deltaFindState + c.state = c.stateTable[lu] +} + +// encode the output symbol provided and write it to the bitstream. +func (c *cState) encode(symbolTT symbolTransform) { + nbBitsOut := (uint32(c.state) + symbolTT.deltaNbBits) >> 16 + dstState := int32(c.state>>(nbBitsOut&15)) + symbolTT.deltaFindState + c.bw.addBits16NC(c.state, uint8(nbBitsOut)) + c.state = c.stateTable[dstState] +} + +// encode the output symbol provided and write it to the bitstream. +func (c *cState) encodeZero(symbolTT symbolTransform) { + nbBitsOut := (uint32(c.state) + symbolTT.deltaNbBits) >> 16 + dstState := int32(c.state>>(nbBitsOut&15)) + symbolTT.deltaFindState + c.bw.addBits16ZeroNC(c.state, uint8(nbBitsOut)) + c.state = c.stateTable[dstState] +} + +// flush will write the tablelog to the output and flush the remaining full bytes. +func (c *cState) flush(tableLog uint8) { + c.bw.flush32() + c.bw.addBits16NC(c.state, tableLog) + c.bw.flush() +} + +// compress is the main compression loop that will encode the input from the last byte to the first. +func (s *Scratch) compress(src []byte) error { + if len(src) <= 2 { + return errors.New("compress: src too small") + } + tt := s.ct.symbolTT[:256] + s.bw.reset(s.Out) + + // Our two states each encodes every second byte. + // Last byte encoded (first byte decoded) will always be encoded by c1. + var c1, c2 cState + + // Encode so remaining size is divisible by 4. + ip := len(src) + if ip&1 == 1 { + c1.init(&s.bw, &s.ct, s.actualTableLog, tt[src[ip-1]]) + c2.init(&s.bw, &s.ct, s.actualTableLog, tt[src[ip-2]]) + c1.encodeZero(tt[src[ip-3]]) + ip -= 3 + } else { + c2.init(&s.bw, &s.ct, s.actualTableLog, tt[src[ip-1]]) + c1.init(&s.bw, &s.ct, s.actualTableLog, tt[src[ip-2]]) + ip -= 2 + } + if ip&2 != 0 { + c2.encodeZero(tt[src[ip-1]]) + c1.encodeZero(tt[src[ip-2]]) + ip -= 2 + } + src = src[:ip] + + // Main compression loop. + switch { + case !s.zeroBits && s.actualTableLog <= 8: + // We can encode 4 symbols without requiring a flush. + // We do not need to check if any output is 0 bits. + for ; len(src) >= 4; src = src[:len(src)-4] { + s.bw.flush32() + v3, v2, v1, v0 := src[len(src)-4], src[len(src)-3], src[len(src)-2], src[len(src)-1] + c2.encode(tt[v0]) + c1.encode(tt[v1]) + c2.encode(tt[v2]) + c1.encode(tt[v3]) + } + case !s.zeroBits: + // We do not need to check if any output is 0 bits. + for ; len(src) >= 4; src = src[:len(src)-4] { + s.bw.flush32() + v3, v2, v1, v0 := src[len(src)-4], src[len(src)-3], src[len(src)-2], src[len(src)-1] + c2.encode(tt[v0]) + c1.encode(tt[v1]) + s.bw.flush32() + c2.encode(tt[v2]) + c1.encode(tt[v3]) + } + case s.actualTableLog <= 8: + // We can encode 4 symbols without requiring a flush + for ; len(src) >= 4; src = src[:len(src)-4] { + s.bw.flush32() + v3, v2, v1, v0 := src[len(src)-4], src[len(src)-3], src[len(src)-2], src[len(src)-1] + c2.encodeZero(tt[v0]) + c1.encodeZero(tt[v1]) + c2.encodeZero(tt[v2]) + c1.encodeZero(tt[v3]) + } + default: + for ; len(src) >= 4; src = src[:len(src)-4] { + s.bw.flush32() + v3, v2, v1, v0 := src[len(src)-4], src[len(src)-3], src[len(src)-2], src[len(src)-1] + c2.encodeZero(tt[v0]) + c1.encodeZero(tt[v1]) + s.bw.flush32() + c2.encodeZero(tt[v2]) + c1.encodeZero(tt[v3]) + } + } + + // Flush final state. + // Used to initialize state when decoding. + c2.flush(s.actualTableLog) + c1.flush(s.actualTableLog) + + return s.bw.close() +} + +// writeCount will write the normalized histogram count to header. +// This is read back by readNCount. +func (s *Scratch) writeCount() error { + var ( + tableLog = s.actualTableLog + tableSize = 1 << tableLog + previous0 bool + charnum uint16 + + maxHeaderSize = ((int(s.symbolLen) * int(tableLog)) >> 3) + 3 + + // Write Table Size + bitStream = uint32(tableLog - minTablelog) + bitCount = uint(4) + remaining = int16(tableSize + 1) /* +1 for extra accuracy */ + threshold = int16(tableSize) + nbBits = uint(tableLog + 1) + ) + if cap(s.Out) < maxHeaderSize { + s.Out = make([]byte, 0, s.br.remain()+maxHeaderSize) + } + outP := uint(0) + out := s.Out[:maxHeaderSize] + + // stops at 1 + for remaining > 1 { + if previous0 { + start := charnum + for s.norm[charnum] == 0 { + charnum++ + } + for charnum >= start+24 { + start += 24 + bitStream += uint32(0xFFFF) << bitCount + out[outP] = byte(bitStream) + out[outP+1] = byte(bitStream >> 8) + outP += 2 + bitStream >>= 16 + } + for charnum >= start+3 { + start += 3 + bitStream += 3 << bitCount + bitCount += 2 + } + bitStream += uint32(charnum-start) << bitCount + bitCount += 2 + if bitCount > 16 { + out[outP] = byte(bitStream) + out[outP+1] = byte(bitStream >> 8) + outP += 2 + bitStream >>= 16 + bitCount -= 16 + } + } + + count := s.norm[charnum] + charnum++ + max := (2*threshold - 1) - remaining + if count < 0 { + remaining += count + } else { + remaining -= count + } + count++ // +1 for extra accuracy + if count >= threshold { + count += max // [0..max[ [max..threshold[ (...) [threshold+max 2*threshold[ + } + bitStream += uint32(count) << bitCount + bitCount += nbBits + if count < max { + bitCount-- + } + + previous0 = count == 1 + if remaining < 1 { + return errors.New("internal error: remaining<1") + } + for remaining < threshold { + nbBits-- + threshold >>= 1 + } + + if bitCount > 16 { + out[outP] = byte(bitStream) + out[outP+1] = byte(bitStream >> 8) + outP += 2 + bitStream >>= 16 + bitCount -= 16 + } + } + + out[outP] = byte(bitStream) + out[outP+1] = byte(bitStream >> 8) + outP += (bitCount + 7) / 8 + + if charnum > s.symbolLen { + return errors.New("internal error: charnum > s.symbolLen") + } + s.Out = out[:outP] + return nil +} + +// symbolTransform contains the state transform for a symbol. +type symbolTransform struct { + deltaFindState int32 + deltaNbBits uint32 +} + +// String prints values as a human readable string. +func (s symbolTransform) String() string { + return fmt.Sprintf("dnbits: %08x, fs:%d", s.deltaNbBits, s.deltaFindState) +} + +// cTable contains tables used for compression. +type cTable struct { + tableSymbol []byte + stateTable []uint16 + symbolTT []symbolTransform +} + +// allocCtable will allocate tables needed for compression. +// If existing tables a re big enough, they are simply re-used. +func (s *Scratch) allocCtable() { + tableSize := 1 << s.actualTableLog + // get tableSymbol that is big enough. + if cap(s.ct.tableSymbol) < tableSize { + s.ct.tableSymbol = make([]byte, tableSize) + } + s.ct.tableSymbol = s.ct.tableSymbol[:tableSize] + + ctSize := tableSize + if cap(s.ct.stateTable) < ctSize { + s.ct.stateTable = make([]uint16, ctSize) + } + s.ct.stateTable = s.ct.stateTable[:ctSize] + + if cap(s.ct.symbolTT) < 256 { + s.ct.symbolTT = make([]symbolTransform, 256) + } + s.ct.symbolTT = s.ct.symbolTT[:256] +} + +// buildCTable will populate the compression table so it is ready to be used. +func (s *Scratch) buildCTable() error { + tableSize := uint32(1 << s.actualTableLog) + highThreshold := tableSize - 1 + var cumul [maxSymbolValue + 2]int16 + + s.allocCtable() + tableSymbol := s.ct.tableSymbol[:tableSize] + // symbol start positions + { + cumul[0] = 0 + for ui, v := range s.norm[:s.symbolLen-1] { + u := byte(ui) // one less than reference + if v == -1 { + // Low proba symbol + cumul[u+1] = cumul[u] + 1 + tableSymbol[highThreshold] = u + highThreshold-- + } else { + cumul[u+1] = cumul[u] + v + } + } + // Encode last symbol separately to avoid overflowing u + u := int(s.symbolLen - 1) + v := s.norm[s.symbolLen-1] + if v == -1 { + // Low proba symbol + cumul[u+1] = cumul[u] + 1 + tableSymbol[highThreshold] = byte(u) + highThreshold-- + } else { + cumul[u+1] = cumul[u] + v + } + if uint32(cumul[s.symbolLen]) != tableSize { + return fmt.Errorf("internal error: expected cumul[s.symbolLen] (%d) == tableSize (%d)", cumul[s.symbolLen], tableSize) + } + cumul[s.symbolLen] = int16(tableSize) + 1 + } + // Spread symbols + s.zeroBits = false + { + step := tableStep(tableSize) + tableMask := tableSize - 1 + var position uint32 + // if any symbol > largeLimit, we may have 0 bits output. + largeLimit := int16(1 << (s.actualTableLog - 1)) + for ui, v := range s.norm[:s.symbolLen] { + symbol := byte(ui) + if v > largeLimit { + s.zeroBits = true + } + for nbOccurrences := int16(0); nbOccurrences < v; nbOccurrences++ { + tableSymbol[position] = symbol + position = (position + step) & tableMask + for position > highThreshold { + position = (position + step) & tableMask + } /* Low proba area */ + } + } + + // Check if we have gone through all positions + if position != 0 { + return errors.New("position!=0") + } + } + + // Build table + table := s.ct.stateTable + { + tsi := int(tableSize) + for u, v := range tableSymbol { + // TableU16 : sorted by symbol order; gives next state value + table[cumul[v]] = uint16(tsi + u) + cumul[v]++ + } + } + + // Build Symbol Transformation Table + { + total := int16(0) + symbolTT := s.ct.symbolTT[:s.symbolLen] + tableLog := s.actualTableLog + tl := (uint32(tableLog) << 16) - (1 << tableLog) + for i, v := range s.norm[:s.symbolLen] { + switch v { + case 0: + case -1, 1: + symbolTT[i].deltaNbBits = tl + symbolTT[i].deltaFindState = int32(total - 1) + total++ + default: + maxBitsOut := uint32(tableLog) - highBits(uint32(v-1)) + minStatePlus := uint32(v) << maxBitsOut + symbolTT[i].deltaNbBits = (maxBitsOut << 16) - minStatePlus + symbolTT[i].deltaFindState = int32(total - v) + total += v + } + } + if total != int16(tableSize) { + return fmt.Errorf("total mismatch %d (got) != %d (want)", total, tableSize) + } + } + return nil +} + +// countSimple will create a simple histogram in s.count. +// Returns the biggest count. +// Does not update s.clearCount. +func (s *Scratch) countSimple(in []byte) (max int) { + for _, v := range in { + s.count[v]++ + } + m, symlen := uint32(0), s.symbolLen + for i, v := range s.count[:] { + if v == 0 { + continue + } + if v > m { + m = v + } + symlen = uint16(i) + 1 + } + s.symbolLen = symlen + return int(m) +} + +// minTableLog provides the minimum logSize to safely represent a distribution. +func (s *Scratch) minTableLog() uint8 { + minBitsSrc := highBits(uint32(s.br.remain()-1)) + 1 + minBitsSymbols := highBits(uint32(s.symbolLen-1)) + 2 + if minBitsSrc < minBitsSymbols { + return uint8(minBitsSrc) + } + return uint8(minBitsSymbols) +} + +// optimalTableLog calculates and sets the optimal tableLog in s.actualTableLog +func (s *Scratch) optimalTableLog() { + tableLog := s.TableLog + minBits := s.minTableLog() + maxBitsSrc := uint8(highBits(uint32(s.br.remain()-1))) - 2 + if maxBitsSrc < tableLog { + // Accuracy can be reduced + tableLog = maxBitsSrc + } + if minBits > tableLog { + tableLog = minBits + } + // Need a minimum to safely represent all symbol values + if tableLog < minTablelog { + tableLog = minTablelog + } + if tableLog > maxTableLog { + tableLog = maxTableLog + } + s.actualTableLog = tableLog +} + +var rtbTable = [...]uint32{0, 473195, 504333, 520860, 550000, 700000, 750000, 830000} + +// normalizeCount will normalize the count of the symbols so +// the total is equal to the table size. +func (s *Scratch) normalizeCount() error { + var ( + tableLog = s.actualTableLog + scale = 62 - uint64(tableLog) + step = (1 << 62) / uint64(s.br.remain()) + vStep = uint64(1) << (scale - 20) + stillToDistribute = int16(1 << tableLog) + largest int + largestP int16 + lowThreshold = (uint32)(s.br.remain() >> tableLog) + ) + + for i, cnt := range s.count[:s.symbolLen] { + // already handled + // if (count[s] == s.length) return 0; /* rle special case */ + + if cnt == 0 { + s.norm[i] = 0 + continue + } + if cnt <= lowThreshold { + s.norm[i] = -1 + stillToDistribute-- + } else { + proba := (int16)((uint64(cnt) * step) >> scale) + if proba < 8 { + restToBeat := vStep * uint64(rtbTable[proba]) + v := uint64(cnt)*step - (uint64(proba) << scale) + if v > restToBeat { + proba++ + } + } + if proba > largestP { + largestP = proba + largest = i + } + s.norm[i] = proba + stillToDistribute -= proba + } + } + + if -stillToDistribute >= (s.norm[largest] >> 1) { + // corner case, need another normalization method + return s.normalizeCount2() + } + s.norm[largest] += stillToDistribute + return nil +} + +// Secondary normalization method. +// To be used when primary method fails. +func (s *Scratch) normalizeCount2() error { + const notYetAssigned = -2 + var ( + distributed uint32 + total = uint32(s.br.remain()) + tableLog = s.actualTableLog + lowThreshold = total >> tableLog + lowOne = (total * 3) >> (tableLog + 1) + ) + for i, cnt := range s.count[:s.symbolLen] { + if cnt == 0 { + s.norm[i] = 0 + continue + } + if cnt <= lowThreshold { + s.norm[i] = -1 + distributed++ + total -= cnt + continue + } + if cnt <= lowOne { + s.norm[i] = 1 + distributed++ + total -= cnt + continue + } + s.norm[i] = notYetAssigned + } + toDistribute := (1 << tableLog) - distributed + + if (total / toDistribute) > lowOne { + // risk of rounding to zero + lowOne = (total * 3) / (toDistribute * 2) + for i, cnt := range s.count[:s.symbolLen] { + if (s.norm[i] == notYetAssigned) && (cnt <= lowOne) { + s.norm[i] = 1 + distributed++ + total -= cnt + continue + } + } + toDistribute = (1 << tableLog) - distributed + } + if distributed == uint32(s.symbolLen)+1 { + // all values are pretty poor; + // probably incompressible data (should have already been detected); + // find max, then give all remaining points to max + var maxV int + var maxC uint32 + for i, cnt := range s.count[:s.symbolLen] { + if cnt > maxC { + maxV = i + maxC = cnt + } + } + s.norm[maxV] += int16(toDistribute) + return nil + } + + if total == 0 { + // all of the symbols were low enough for the lowOne or lowThreshold + for i := uint32(0); toDistribute > 0; i = (i + 1) % (uint32(s.symbolLen)) { + if s.norm[i] > 0 { + toDistribute-- + s.norm[i]++ + } + } + return nil + } + + var ( + vStepLog = 62 - uint64(tableLog) + mid = uint64((1 << (vStepLog - 1)) - 1) + rStep = (((1 << vStepLog) * uint64(toDistribute)) + mid) / uint64(total) // scale on remaining + tmpTotal = mid + ) + for i, cnt := range s.count[:s.symbolLen] { + if s.norm[i] == notYetAssigned { + var ( + end = tmpTotal + uint64(cnt)*rStep + sStart = uint32(tmpTotal >> vStepLog) + sEnd = uint32(end >> vStepLog) + weight = sEnd - sStart + ) + if weight < 1 { + return errors.New("weight < 1") + } + s.norm[i] = int16(weight) + tmpTotal = end + } + } + return nil +} + +// validateNorm validates the normalized histogram table. +func (s *Scratch) validateNorm() (err error) { + var total int + for _, v := range s.norm[:s.symbolLen] { + if v >= 0 { + total += int(v) + } else { + total -= int(v) + } + } + defer func() { + if err == nil { + return + } + fmt.Printf("selected TableLog: %d, Symbol length: %d\n", s.actualTableLog, s.symbolLen) + for i, v := range s.norm[:s.symbolLen] { + fmt.Printf("%3d: %5d -> %4d \n", i, s.count[i], v) + } + }() + if total != (1 << s.actualTableLog) { + return fmt.Errorf("warning: Total == %d != %d", total, 1< tablelogAbsoluteMax { + return errors.New("tableLog too large") + } + bitStream >>= 4 + bitCount := uint(4) + + s.actualTableLog = uint8(nbBits) + remaining := int32((1 << nbBits) + 1) + threshold := int32(1 << nbBits) + gotTotal := int32(0) + nbBits++ + + for remaining > 1 { + if previous0 { + n0 := charnum + for (bitStream & 0xFFFF) == 0xFFFF { + n0 += 24 + if b.off < iend-5 { + b.advance(2) + bitStream = b.Uint32() >> bitCount + } else { + bitStream >>= 16 + bitCount += 16 + } + } + for (bitStream & 3) == 3 { + n0 += 3 + bitStream >>= 2 + bitCount += 2 + } + n0 += uint16(bitStream & 3) + bitCount += 2 + if n0 > maxSymbolValue { + return errors.New("maxSymbolValue too small") + } + for charnum < n0 { + s.norm[charnum&0xff] = 0 + charnum++ + } + + if b.off <= iend-7 || b.off+int(bitCount>>3) <= iend-4 { + b.advance(bitCount >> 3) + bitCount &= 7 + bitStream = b.Uint32() >> bitCount + } else { + bitStream >>= 2 + } + } + + max := (2*(threshold) - 1) - (remaining) + var count int32 + + if (int32(bitStream) & (threshold - 1)) < max { + count = int32(bitStream) & (threshold - 1) + bitCount += nbBits - 1 + } else { + count = int32(bitStream) & (2*threshold - 1) + if count >= threshold { + count -= max + } + bitCount += nbBits + } + + count-- // extra accuracy + if count < 0 { + // -1 means +1 + remaining += count + gotTotal -= count + } else { + remaining -= count + gotTotal += count + } + s.norm[charnum&0xff] = int16(count) + charnum++ + previous0 = count == 0 + for remaining < threshold { + nbBits-- + threshold >>= 1 + } + if b.off <= iend-7 || b.off+int(bitCount>>3) <= iend-4 { + b.advance(bitCount >> 3) + bitCount &= 7 + } else { + bitCount -= (uint)(8 * (len(b.b) - 4 - b.off)) + b.off = len(b.b) - 4 + } + bitStream = b.Uint32() >> (bitCount & 31) + } + s.symbolLen = charnum + + if s.symbolLen <= 1 { + return fmt.Errorf("symbolLen (%d) too small", s.symbolLen) + } + if s.symbolLen > maxSymbolValue+1 { + return fmt.Errorf("symbolLen (%d) too big", s.symbolLen) + } + if remaining != 1 { + return fmt.Errorf("corruption detected (remaining %d != 1)", remaining) + } + if bitCount > 32 { + return fmt.Errorf("corruption detected (bitCount %d > 32)", bitCount) + } + if gotTotal != 1<> 3) + return nil +} + +// decSymbol contains information about a state entry, +// Including the state offset base, the output symbol and +// the number of bits to read for the low part of the destination state. +type decSymbol struct { + newState uint16 + symbol uint8 + nbBits uint8 +} + +// allocDtable will allocate decoding tables if they are not big enough. +func (s *Scratch) allocDtable() { + tableSize := 1 << s.actualTableLog + if cap(s.decTable) < tableSize { + s.decTable = make([]decSymbol, tableSize) + } + s.decTable = s.decTable[:tableSize] + + if cap(s.ct.tableSymbol) < 256 { + s.ct.tableSymbol = make([]byte, 256) + } + s.ct.tableSymbol = s.ct.tableSymbol[:256] + + if cap(s.ct.stateTable) < 256 { + s.ct.stateTable = make([]uint16, 256) + } + s.ct.stateTable = s.ct.stateTable[:256] +} + +// buildDtable will build the decoding table. +func (s *Scratch) buildDtable() error { + tableSize := uint32(1 << s.actualTableLog) + highThreshold := tableSize - 1 + s.allocDtable() + symbolNext := s.ct.stateTable[:256] + + // Init, lay down lowprob symbols + s.zeroBits = false + { + largeLimit := int16(1 << (s.actualTableLog - 1)) + for i, v := range s.norm[:s.symbolLen] { + if v == -1 { + s.decTable[highThreshold].symbol = uint8(i) + highThreshold-- + symbolNext[i] = 1 + } else { + if v >= largeLimit { + s.zeroBits = true + } + symbolNext[i] = uint16(v) + } + } + } + // Spread symbols + { + tableMask := tableSize - 1 + step := tableStep(tableSize) + position := uint32(0) + for ss, v := range s.norm[:s.symbolLen] { + for i := 0; i < int(v); i++ { + s.decTable[position].symbol = uint8(ss) + position = (position + step) & tableMask + for position > highThreshold { + // lowprob area + position = (position + step) & tableMask + } + } + } + if position != 0 { + // position must reach all cells once, otherwise normalizedCounter is incorrect + return errors.New("corrupted input (position != 0)") + } + } + + // Build Decoding table + { + tableSize := uint16(1 << s.actualTableLog) + for u, v := range s.decTable { + symbol := v.symbol + nextState := symbolNext[symbol] + symbolNext[symbol] = nextState + 1 + nBits := s.actualTableLog - byte(highBits(uint32(nextState))) + s.decTable[u].nbBits = nBits + newState := (nextState << nBits) - tableSize + if newState >= tableSize { + return fmt.Errorf("newState (%d) outside table size (%d)", newState, tableSize) + } + if newState == uint16(u) && nBits == 0 { + // Seems weird that this is possible with nbits > 0. + return fmt.Errorf("newState (%d) == oldState (%d) and no bits", newState, u) + } + s.decTable[u].newState = newState + } + } + return nil +} + +// decompress will decompress the bitstream. +// If the buffer is over-read an error is returned. +func (s *Scratch) decompress() error { + br := &s.bits + if err := br.init(s.br.unread()); err != nil { + return err + } + + var s1, s2 decoder + // Initialize and decode first state and symbol. + s1.init(br, s.decTable, s.actualTableLog) + s2.init(br, s.decTable, s.actualTableLog) + + // Use temp table to avoid bound checks/append penalty. + var tmp = s.ct.tableSymbol[:256] + var off uint8 + + // Main part + if !s.zeroBits { + for br.off >= 8 { + br.fillFast() + tmp[off+0] = s1.nextFast() + tmp[off+1] = s2.nextFast() + br.fillFast() + tmp[off+2] = s1.nextFast() + tmp[off+3] = s2.nextFast() + off += 4 + // When off is 0, we have overflowed and should write. + if off == 0 { + s.Out = append(s.Out, tmp...) + if len(s.Out) >= s.DecompressLimit { + return fmt.Errorf("output size (%d) > DecompressLimit (%d)", len(s.Out), s.DecompressLimit) + } + } + } + } else { + for br.off >= 8 { + br.fillFast() + tmp[off+0] = s1.next() + tmp[off+1] = s2.next() + br.fillFast() + tmp[off+2] = s1.next() + tmp[off+3] = s2.next() + off += 4 + if off == 0 { + s.Out = append(s.Out, tmp...) + // When off is 0, we have overflowed and should write. + if len(s.Out) >= s.DecompressLimit { + return fmt.Errorf("output size (%d) > DecompressLimit (%d)", len(s.Out), s.DecompressLimit) + } + } + } + } + s.Out = append(s.Out, tmp[:off]...) + + // Final bits, a bit more expensive check + for { + if s1.finished() { + s.Out = append(s.Out, s1.final(), s2.final()) + break + } + br.fill() + s.Out = append(s.Out, s1.next()) + if s2.finished() { + s.Out = append(s.Out, s2.final(), s1.final()) + break + } + s.Out = append(s.Out, s2.next()) + if len(s.Out) >= s.DecompressLimit { + return fmt.Errorf("output size (%d) > DecompressLimit (%d)", len(s.Out), s.DecompressLimit) + } + } + return br.close() +} + +// decoder keeps track of the current state and updates it from the bitstream. +type decoder struct { + state uint16 + br *bitReader + dt []decSymbol +} + +// init will initialize the decoder and read the first state from the stream. +func (d *decoder) init(in *bitReader, dt []decSymbol, tableLog uint8) { + d.dt = dt + d.br = in + d.state = in.getBits(tableLog) +} + +// next returns the next symbol and sets the next state. +// At least tablelog bits must be available in the bit reader. +func (d *decoder) next() uint8 { + n := &d.dt[d.state] + lowBits := d.br.getBits(n.nbBits) + d.state = n.newState + lowBits + return n.symbol +} + +// finished returns true if all bits have been read from the bitstream +// and the next state would require reading bits from the input. +func (d *decoder) finished() bool { + return d.br.finished() && d.dt[d.state].nbBits > 0 +} + +// final returns the current state symbol without decoding the next. +func (d *decoder) final() uint8 { + return d.dt[d.state].symbol +} + +// nextFast returns the next symbol and sets the next state. +// This can only be used if no symbols are 0 bits. +// At least tablelog bits must be available in the bit reader. +func (d *decoder) nextFast() uint8 { + n := d.dt[d.state] + lowBits := d.br.getBitsFast(n.nbBits) + d.state = n.newState + lowBits + return n.symbol +} diff --git a/vendor/github.com/klauspost/compress/fse/fse.go b/vendor/github.com/klauspost/compress/fse/fse.go new file mode 100644 index 000000000..535cbadfd --- /dev/null +++ b/vendor/github.com/klauspost/compress/fse/fse.go @@ -0,0 +1,144 @@ +// Copyright 2018 Klaus Post. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. +// Based on work Copyright (c) 2013, Yann Collet, released under BSD License. + +// Package fse provides Finite State Entropy encoding and decoding. +// +// Finite State Entropy encoding provides a fast near-optimal symbol encoding/decoding +// for byte blocks as implemented in zstd. +// +// See https://github.com/klauspost/compress/tree/master/fse for more information. +package fse + +import ( + "errors" + "fmt" + "math/bits" +) + +const ( + /*!MEMORY_USAGE : + * Memory usage formula : N->2^N Bytes (examples : 10 -> 1KB; 12 -> 4KB ; 16 -> 64KB; 20 -> 1MB; etc.) + * Increasing memory usage improves compression ratio + * Reduced memory usage can improve speed, due to cache effect + * Recommended max value is 14, for 16KB, which nicely fits into Intel x86 L1 cache */ + maxMemoryUsage = 14 + defaultMemoryUsage = 13 + + maxTableLog = maxMemoryUsage - 2 + maxTablesize = 1 << maxTableLog + defaultTablelog = defaultMemoryUsage - 2 + minTablelog = 5 + maxSymbolValue = 255 +) + +var ( + // ErrIncompressible is returned when input is judged to be too hard to compress. + ErrIncompressible = errors.New("input is not compressible") + + // ErrUseRLE is returned from the compressor when the input is a single byte value repeated. + ErrUseRLE = errors.New("input is single value repeated") +) + +// Scratch provides temporary storage for compression and decompression. +type Scratch struct { + // Private + count [maxSymbolValue + 1]uint32 + norm [maxSymbolValue + 1]int16 + br byteReader + bits bitReader + bw bitWriter + ct cTable // Compression tables. + decTable []decSymbol // Decompression table. + maxCount int // count of the most probable symbol + + // Per block parameters. + // These can be used to override compression parameters of the block. + // Do not touch, unless you know what you are doing. + + // Out is output buffer. + // If the scratch is re-used before the caller is done processing the output, + // set this field to nil. + // Otherwise the output buffer will be re-used for next Compression/Decompression step + // and allocation will be avoided. + Out []byte + + // DecompressLimit limits the maximum decoded size acceptable. + // If > 0 decompression will stop when approximately this many bytes + // has been decoded. + // If 0, maximum size will be 2GB. + DecompressLimit int + + symbolLen uint16 // Length of active part of the symbol table. + actualTableLog uint8 // Selected tablelog. + zeroBits bool // no bits has prob > 50%. + clearCount bool // clear count + + // MaxSymbolValue will override the maximum symbol value of the next block. + MaxSymbolValue uint8 + + // TableLog will attempt to override the tablelog for the next block. + TableLog uint8 +} + +// Histogram allows to populate the histogram and skip that step in the compression, +// It otherwise allows to inspect the histogram when compression is done. +// To indicate that you have populated the histogram call HistogramFinished +// with the value of the highest populated symbol, as well as the number of entries +// in the most populated entry. These are accepted at face value. +// The returned slice will always be length 256. +func (s *Scratch) Histogram() []uint32 { + return s.count[:] +} + +// HistogramFinished can be called to indicate that the histogram has been populated. +// maxSymbol is the index of the highest set symbol of the next data segment. +// maxCount is the number of entries in the most populated entry. +// These are accepted at face value. +func (s *Scratch) HistogramFinished(maxSymbol uint8, maxCount int) { + s.maxCount = maxCount + s.symbolLen = uint16(maxSymbol) + 1 + s.clearCount = maxCount != 0 +} + +// prepare will prepare and allocate scratch tables used for both compression and decompression. +func (s *Scratch) prepare(in []byte) (*Scratch, error) { + if s == nil { + s = &Scratch{} + } + if s.MaxSymbolValue == 0 { + s.MaxSymbolValue = 255 + } + if s.TableLog == 0 { + s.TableLog = defaultTablelog + } + if s.TableLog > maxTableLog { + return nil, fmt.Errorf("tableLog (%d) > maxTableLog (%d)", s.TableLog, maxTableLog) + } + if cap(s.Out) == 0 { + s.Out = make([]byte, 0, len(in)) + } + if s.clearCount && s.maxCount == 0 { + for i := range s.count { + s.count[i] = 0 + } + s.clearCount = false + } + s.br.init(in) + if s.DecompressLimit == 0 { + // Max size 2GB. + s.DecompressLimit = (2 << 30) - 1 + } + + return s, nil +} + +// tableStep returns the next table index. +func tableStep(tableSize uint32) uint32 { + return (tableSize >> 1) + (tableSize >> 3) + 3 +} + +func highBits(val uint32) (n uint32) { + return uint32(bits.Len32(val) - 1) +} diff --git a/vendor/github.com/klauspost/compress/gen.sh b/vendor/github.com/klauspost/compress/gen.sh new file mode 100644 index 000000000..aff942205 --- /dev/null +++ b/vendor/github.com/klauspost/compress/gen.sh @@ -0,0 +1,4 @@ +#!/bin/sh + +cd s2/cmd/_s2sx/ || exit 1 +go generate . diff --git a/vendor/github.com/klauspost/compress/huff0/.gitignore b/vendor/github.com/klauspost/compress/huff0/.gitignore new file mode 100644 index 000000000..b3d262958 --- /dev/null +++ b/vendor/github.com/klauspost/compress/huff0/.gitignore @@ -0,0 +1 @@ +/huff0-fuzz.zip diff --git a/vendor/github.com/klauspost/compress/huff0/README.md b/vendor/github.com/klauspost/compress/huff0/README.md new file mode 100644 index 000000000..8b6e5c663 --- /dev/null +++ b/vendor/github.com/klauspost/compress/huff0/README.md @@ -0,0 +1,89 @@ +# Huff0 entropy compression + +This package provides Huff0 encoding and decoding as used in zstd. + +[Huff0](https://github.com/Cyan4973/FiniteStateEntropy#new-generation-entropy-coders), +a Huffman codec designed for modern CPU, featuring OoO (Out of Order) operations on multiple ALU +(Arithmetic Logic Unit), achieving extremely fast compression and decompression speeds. + +This can be used for compressing input with a lot of similar input values to the smallest number of bytes. +This does not perform any multi-byte [dictionary coding](https://en.wikipedia.org/wiki/Dictionary_coder) as LZ coders, +but it can be used as a secondary step to compressors (like Snappy) that does not do entropy encoding. + +* [Godoc documentation](https://godoc.org/github.com/klauspost/compress/huff0) + +## News + +This is used as part of the [zstandard](https://github.com/klauspost/compress/tree/master/zstd#zstd) compression and decompression package. + +This ensures that most functionality is well tested. + +# Usage + +This package provides a low level interface that allows to compress single independent blocks. + +Each block is separate, and there is no built in integrity checks. +This means that the caller should keep track of block sizes and also do checksums if needed. + +Compressing a block is done via the [`Compress1X`](https://godoc.org/github.com/klauspost/compress/huff0#Compress1X) and +[`Compress4X`](https://godoc.org/github.com/klauspost/compress/huff0#Compress4X) functions. +You must provide input and will receive the output and maybe an error. + +These error values can be returned: + +| Error | Description | +|---------------------|-----------------------------------------------------------------------------| +| `` | Everything ok, output is returned | +| `ErrIncompressible` | Returned when input is judged to be too hard to compress | +| `ErrUseRLE` | Returned from the compressor when the input is a single byte value repeated | +| `ErrTooBig` | Returned if the input block exceeds the maximum allowed size (128 Kib) | +| `(error)` | An internal error occurred. | + + +As can be seen above some of there are errors that will be returned even under normal operation so it is important to handle these. + +To reduce allocations you can provide a [`Scratch`](https://godoc.org/github.com/klauspost/compress/huff0#Scratch) object +that can be re-used for successive calls. Both compression and decompression accepts a `Scratch` object, and the same +object can be used for both. + +Be aware, that when re-using a `Scratch` object that the *output* buffer is also re-used, so if you are still using this +you must set the `Out` field in the scratch to nil. The same buffer is used for compression and decompression output. + +The `Scratch` object will retain state that allows to re-use previous tables for encoding and decoding. + +## Tables and re-use + +Huff0 allows for reusing tables from the previous block to save space if that is expected to give better/faster results. + +The Scratch object allows you to set a [`ReusePolicy`](https://godoc.org/github.com/klauspost/compress/huff0#ReusePolicy) +that controls this behaviour. See the documentation for details. This can be altered between each block. + +Do however note that this information is *not* stored in the output block and it is up to the users of the package to +record whether [`ReadTable`](https://godoc.org/github.com/klauspost/compress/huff0#ReadTable) should be called, +based on the boolean reported back from the CompressXX call. + +If you want to store the table separate from the data, you can access them as `OutData` and `OutTable` on the +[`Scratch`](https://godoc.org/github.com/klauspost/compress/huff0#Scratch) object. + +## Decompressing + +The first part of decoding is to initialize the decoding table through [`ReadTable`](https://godoc.org/github.com/klauspost/compress/huff0#ReadTable). +This will initialize the decoding tables. +You can supply the complete block to `ReadTable` and it will return the data part of the block +which can be given to the decompressor. + +Decompressing is done by calling the [`Decompress1X`](https://godoc.org/github.com/klauspost/compress/huff0#Scratch.Decompress1X) +or [`Decompress4X`](https://godoc.org/github.com/klauspost/compress/huff0#Scratch.Decompress4X) function. + +For concurrently decompressing content with a fixed table a stateless [`Decoder`](https://godoc.org/github.com/klauspost/compress/huff0#Decoder) can be requested which will remain correct as long as the scratch is unchanged. The capacity of the provided slice indicates the expected output size. + +You must provide the output from the compression stage, at exactly the size you got back. If you receive an error back +your input was likely corrupted. + +It is important to note that a successful decoding does *not* mean your output matches your original input. +There are no integrity checks, so relying on errors from the decompressor does not assure your data is valid. + +# Contributing + +Contributions are always welcome. Be aware that adding public functions will require good justification and breaking +changes will likely not be accepted. If in doubt open an issue before writing the PR. diff --git a/vendor/github.com/klauspost/compress/huff0/bitreader.go b/vendor/github.com/klauspost/compress/huff0/bitreader.go new file mode 100644 index 000000000..e36d9742f --- /dev/null +++ b/vendor/github.com/klauspost/compress/huff0/bitreader.go @@ -0,0 +1,229 @@ +// Copyright 2018 Klaus Post. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. +// Based on work Copyright (c) 2013, Yann Collet, released under BSD License. + +package huff0 + +import ( + "encoding/binary" + "errors" + "fmt" + "io" +) + +// bitReader reads a bitstream in reverse. +// The last set bit indicates the start of the stream and is used +// for aligning the input. +type bitReaderBytes struct { + in []byte + off uint // next byte to read is at in[off - 1] + value uint64 + bitsRead uint8 +} + +// init initializes and resets the bit reader. +func (b *bitReaderBytes) init(in []byte) error { + if len(in) < 1 { + return errors.New("corrupt stream: too short") + } + b.in = in + b.off = uint(len(in)) + // The highest bit of the last byte indicates where to start + v := in[len(in)-1] + if v == 0 { + return errors.New("corrupt stream, did not find end of stream") + } + b.bitsRead = 64 + b.value = 0 + if len(in) >= 8 { + b.fillFastStart() + } else { + b.fill() + b.fill() + } + b.advance(8 - uint8(highBit32(uint32(v)))) + return nil +} + +// peekBitsFast requires that at least one bit is requested every time. +// There are no checks if the buffer is filled. +func (b *bitReaderBytes) peekByteFast() uint8 { + got := uint8(b.value >> 56) + return got +} + +func (b *bitReaderBytes) advance(n uint8) { + b.bitsRead += n + b.value <<= n & 63 +} + +// fillFast() will make sure at least 32 bits are available. +// There must be at least 4 bytes available. +func (b *bitReaderBytes) fillFast() { + if b.bitsRead < 32 { + return + } + + // 2 bounds checks. + v := b.in[b.off-4 : b.off] + low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + b.value |= uint64(low) << (b.bitsRead - 32) + b.bitsRead -= 32 + b.off -= 4 +} + +// fillFastStart() assumes the bitReaderBytes is empty and there is at least 8 bytes to read. +func (b *bitReaderBytes) fillFastStart() { + // Do single re-slice to avoid bounds checks. + b.value = binary.LittleEndian.Uint64(b.in[b.off-8:]) + b.bitsRead = 0 + b.off -= 8 +} + +// fill() will make sure at least 32 bits are available. +func (b *bitReaderBytes) fill() { + if b.bitsRead < 32 { + return + } + if b.off > 4 { + v := b.in[b.off-4 : b.off] + low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + b.value |= uint64(low) << (b.bitsRead - 32) + b.bitsRead -= 32 + b.off -= 4 + return + } + for b.off > 0 { + b.value |= uint64(b.in[b.off-1]) << (b.bitsRead - 8) + b.bitsRead -= 8 + b.off-- + } +} + +// finished returns true if all bits have been read from the bit stream. +func (b *bitReaderBytes) finished() bool { + return b.off == 0 && b.bitsRead >= 64 +} + +func (b *bitReaderBytes) remaining() uint { + return b.off*8 + uint(64-b.bitsRead) +} + +// close the bitstream and returns an error if out-of-buffer reads occurred. +func (b *bitReaderBytes) close() error { + // Release reference. + b.in = nil + if b.remaining() > 0 { + return fmt.Errorf("corrupt input: %d bits remain on stream", b.remaining()) + } + if b.bitsRead > 64 { + return io.ErrUnexpectedEOF + } + return nil +} + +// bitReaderShifted reads a bitstream in reverse. +// The last set bit indicates the start of the stream and is used +// for aligning the input. +type bitReaderShifted struct { + in []byte + off uint // next byte to read is at in[off - 1] + value uint64 + bitsRead uint8 +} + +// init initializes and resets the bit reader. +func (b *bitReaderShifted) init(in []byte) error { + if len(in) < 1 { + return errors.New("corrupt stream: too short") + } + b.in = in + b.off = uint(len(in)) + // The highest bit of the last byte indicates where to start + v := in[len(in)-1] + if v == 0 { + return errors.New("corrupt stream, did not find end of stream") + } + b.bitsRead = 64 + b.value = 0 + if len(in) >= 8 { + b.fillFastStart() + } else { + b.fill() + b.fill() + } + b.advance(8 - uint8(highBit32(uint32(v)))) + return nil +} + +// peekBitsFast requires that at least one bit is requested every time. +// There are no checks if the buffer is filled. +func (b *bitReaderShifted) peekBitsFast(n uint8) uint16 { + return uint16(b.value >> ((64 - n) & 63)) +} + +func (b *bitReaderShifted) advance(n uint8) { + b.bitsRead += n + b.value <<= n & 63 +} + +// fillFast() will make sure at least 32 bits are available. +// There must be at least 4 bytes available. +func (b *bitReaderShifted) fillFast() { + if b.bitsRead < 32 { + return + } + + // 2 bounds checks. + v := b.in[b.off-4 : b.off] + low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + b.value |= uint64(low) << ((b.bitsRead - 32) & 63) + b.bitsRead -= 32 + b.off -= 4 +} + +// fillFastStart() assumes the bitReaderShifted is empty and there is at least 8 bytes to read. +func (b *bitReaderShifted) fillFastStart() { + // Do single re-slice to avoid bounds checks. + b.value = binary.LittleEndian.Uint64(b.in[b.off-8:]) + b.bitsRead = 0 + b.off -= 8 +} + +// fill() will make sure at least 32 bits are available. +func (b *bitReaderShifted) fill() { + if b.bitsRead < 32 { + return + } + if b.off > 4 { + v := b.in[b.off-4 : b.off] + low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + b.value |= uint64(low) << ((b.bitsRead - 32) & 63) + b.bitsRead -= 32 + b.off -= 4 + return + } + for b.off > 0 { + b.value |= uint64(b.in[b.off-1]) << ((b.bitsRead - 8) & 63) + b.bitsRead -= 8 + b.off-- + } +} + +func (b *bitReaderShifted) remaining() uint { + return b.off*8 + uint(64-b.bitsRead) +} + +// close the bitstream and returns an error if out-of-buffer reads occurred. +func (b *bitReaderShifted) close() error { + // Release reference. + b.in = nil + if b.remaining() > 0 { + return fmt.Errorf("corrupt input: %d bits remain on stream", b.remaining()) + } + if b.bitsRead > 64 { + return io.ErrUnexpectedEOF + } + return nil +} diff --git a/vendor/github.com/klauspost/compress/huff0/bitwriter.go b/vendor/github.com/klauspost/compress/huff0/bitwriter.go new file mode 100644 index 000000000..b4d7164e3 --- /dev/null +++ b/vendor/github.com/klauspost/compress/huff0/bitwriter.go @@ -0,0 +1,103 @@ +// Copyright 2018 Klaus Post. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. +// Based on work Copyright (c) 2013, Yann Collet, released under BSD License. + +package huff0 + +// bitWriter will write bits. +// First bit will be LSB of the first byte of output. +type bitWriter struct { + bitContainer uint64 + nBits uint8 + out []byte +} + +// addBits16Clean will add up to 16 bits. value may not contain more set bits than indicated. +// It will not check if there is space for them, so the caller must ensure that it has flushed recently. +func (b *bitWriter) addBits16Clean(value uint16, bits uint8) { + b.bitContainer |= uint64(value) << (b.nBits & 63) + b.nBits += bits +} + +// encSymbol will add up to 16 bits. value may not contain more set bits than indicated. +// It will not check if there is space for them, so the caller must ensure that it has flushed recently. +func (b *bitWriter) encSymbol(ct cTable, symbol byte) { + enc := ct[symbol] + b.bitContainer |= uint64(enc.val) << (b.nBits & 63) + if false { + if enc.nBits == 0 { + panic("nbits 0") + } + } + b.nBits += enc.nBits +} + +// encTwoSymbols will add up to 32 bits. value may not contain more set bits than indicated. +// It will not check if there is space for them, so the caller must ensure that it has flushed recently. +func (b *bitWriter) encTwoSymbols(ct cTable, av, bv byte) { + encA := ct[av] + encB := ct[bv] + sh := b.nBits & 63 + combined := uint64(encA.val) | (uint64(encB.val) << (encA.nBits & 63)) + b.bitContainer |= combined << sh + if false { + if encA.nBits == 0 { + panic("nbitsA 0") + } + if encB.nBits == 0 { + panic("nbitsB 0") + } + } + b.nBits += encA.nBits + encB.nBits +} + +// encFourSymbols adds up to 32 bits from four symbols. +// It will not check if there is space for them, +// so the caller must ensure that b has been flushed recently. +func (b *bitWriter) encFourSymbols(encA, encB, encC, encD cTableEntry) { + bitsA := encA.nBits + bitsB := bitsA + encB.nBits + bitsC := bitsB + encC.nBits + bitsD := bitsC + encD.nBits + combined := uint64(encA.val) | + (uint64(encB.val) << (bitsA & 63)) | + (uint64(encC.val) << (bitsB & 63)) | + (uint64(encD.val) << (bitsC & 63)) + b.bitContainer |= combined << (b.nBits & 63) + b.nBits += bitsD +} + +// flush32 will flush out, so there are at least 32 bits available for writing. +func (b *bitWriter) flush32() { + if b.nBits < 32 { + return + } + b.out = append(b.out, + byte(b.bitContainer), + byte(b.bitContainer>>8), + byte(b.bitContainer>>16), + byte(b.bitContainer>>24)) + b.nBits -= 32 + b.bitContainer >>= 32 +} + +// flushAlign will flush remaining full bytes and align to next byte boundary. +func (b *bitWriter) flushAlign() { + nbBytes := (b.nBits + 7) >> 3 + for i := uint8(0); i < nbBytes; i++ { + b.out = append(b.out, byte(b.bitContainer>>(i*8))) + } + b.nBits = 0 + b.bitContainer = 0 +} + +// close will write the alignment bit and write the final byte(s) +// to the output. +func (b *bitWriter) close() error { + // End mark + b.addBits16Clean(1, 1) + // flush until next byte. + b.flushAlign() + return nil +} diff --git a/vendor/github.com/klauspost/compress/huff0/bytereader.go b/vendor/github.com/klauspost/compress/huff0/bytereader.go new file mode 100644 index 000000000..4dcab8d23 --- /dev/null +++ b/vendor/github.com/klauspost/compress/huff0/bytereader.go @@ -0,0 +1,44 @@ +// Copyright 2018 Klaus Post. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. +// Based on work Copyright (c) 2013, Yann Collet, released under BSD License. + +package huff0 + +// byteReader provides a byte reader that reads +// little endian values from a byte stream. +// The input stream is manually advanced. +// The reader performs no bounds checks. +type byteReader struct { + b []byte + off int +} + +// init will initialize the reader and set the input. +func (b *byteReader) init(in []byte) { + b.b = in + b.off = 0 +} + +// Int32 returns a little endian int32 starting at current offset. +func (b byteReader) Int32() int32 { + v3 := int32(b.b[b.off+3]) + v2 := int32(b.b[b.off+2]) + v1 := int32(b.b[b.off+1]) + v0 := int32(b.b[b.off]) + return (v3 << 24) | (v2 << 16) | (v1 << 8) | v0 +} + +// Uint32 returns a little endian uint32 starting at current offset. +func (b byteReader) Uint32() uint32 { + v3 := uint32(b.b[b.off+3]) + v2 := uint32(b.b[b.off+2]) + v1 := uint32(b.b[b.off+1]) + v0 := uint32(b.b[b.off]) + return (v3 << 24) | (v2 << 16) | (v1 << 8) | v0 +} + +// remain will return the number of bytes remaining. +func (b byteReader) remain() int { + return len(b.b) - b.off +} diff --git a/vendor/github.com/klauspost/compress/huff0/compress.go b/vendor/github.com/klauspost/compress/huff0/compress.go new file mode 100644 index 000000000..4ee4fa18d --- /dev/null +++ b/vendor/github.com/klauspost/compress/huff0/compress.go @@ -0,0 +1,749 @@ +package huff0 + +import ( + "fmt" + "math" + "runtime" + "sync" +) + +// Compress1X will compress the input. +// The output can be decoded using Decompress1X. +// Supply a Scratch object. The scratch object contains state about re-use, +// So when sharing across independent encodes, be sure to set the re-use policy. +func Compress1X(in []byte, s *Scratch) (out []byte, reUsed bool, err error) { + s, err = s.prepare(in) + if err != nil { + return nil, false, err + } + return compress(in, s, s.compress1X) +} + +// Compress4X will compress the input. The input is split into 4 independent blocks +// and compressed similar to Compress1X. +// The output can be decoded using Decompress4X. +// Supply a Scratch object. The scratch object contains state about re-use, +// So when sharing across independent encodes, be sure to set the re-use policy. +func Compress4X(in []byte, s *Scratch) (out []byte, reUsed bool, err error) { + s, err = s.prepare(in) + if err != nil { + return nil, false, err + } + if false { + // TODO: compress4Xp only slightly faster. + const parallelThreshold = 8 << 10 + if len(in) < parallelThreshold || runtime.GOMAXPROCS(0) == 1 { + return compress(in, s, s.compress4X) + } + return compress(in, s, s.compress4Xp) + } + return compress(in, s, s.compress4X) +} + +func compress(in []byte, s *Scratch, compressor func(src []byte) ([]byte, error)) (out []byte, reUsed bool, err error) { + // Nuke previous table if we cannot reuse anyway. + if s.Reuse == ReusePolicyNone { + s.prevTable = s.prevTable[:0] + } + + // Create histogram, if none was provided. + maxCount := s.maxCount + var canReuse = false + if maxCount == 0 { + maxCount, canReuse = s.countSimple(in) + } else { + canReuse = s.canUseTable(s.prevTable) + } + + // We want the output size to be less than this: + wantSize := len(in) + if s.WantLogLess > 0 { + wantSize -= wantSize >> s.WantLogLess + } + + // Reset for next run. + s.clearCount = true + s.maxCount = 0 + if maxCount >= len(in) { + if maxCount > len(in) { + return nil, false, fmt.Errorf("maxCount (%d) > length (%d)", maxCount, len(in)) + } + if len(in) == 1 { + return nil, false, ErrIncompressible + } + // One symbol, use RLE + return nil, false, ErrUseRLE + } + if maxCount == 1 || maxCount < (len(in)>>7) { + // Each symbol present maximum once or too well distributed. + return nil, false, ErrIncompressible + } + if s.Reuse == ReusePolicyMust && !canReuse { + // We must reuse, but we can't. + return nil, false, ErrIncompressible + } + if (s.Reuse == ReusePolicyPrefer || s.Reuse == ReusePolicyMust) && canReuse { + keepTable := s.cTable + keepTL := s.actualTableLog + s.cTable = s.prevTable + s.actualTableLog = s.prevTableLog + s.Out, err = compressor(in) + s.cTable = keepTable + s.actualTableLog = keepTL + if err == nil && len(s.Out) < wantSize { + s.OutData = s.Out + return s.Out, true, nil + } + if s.Reuse == ReusePolicyMust { + return nil, false, ErrIncompressible + } + // Do not attempt to re-use later. + s.prevTable = s.prevTable[:0] + } + + // Calculate new table. + err = s.buildCTable() + if err != nil { + return nil, false, err + } + + if false && !s.canUseTable(s.cTable) { + panic("invalid table generated") + } + + if s.Reuse == ReusePolicyAllow && canReuse { + hSize := len(s.Out) + oldSize := s.prevTable.estimateSize(s.count[:s.symbolLen]) + newSize := s.cTable.estimateSize(s.count[:s.symbolLen]) + if oldSize <= hSize+newSize || hSize+12 >= wantSize { + // Retain cTable even if we re-use. + keepTable := s.cTable + keepTL := s.actualTableLog + + s.cTable = s.prevTable + s.actualTableLog = s.prevTableLog + s.Out, err = compressor(in) + + // Restore ctable. + s.cTable = keepTable + s.actualTableLog = keepTL + if err != nil { + return nil, false, err + } + if len(s.Out) >= wantSize { + return nil, false, ErrIncompressible + } + s.OutData = s.Out + return s.Out, true, nil + } + } + + // Use new table + err = s.cTable.write(s) + if err != nil { + s.OutTable = nil + return nil, false, err + } + s.OutTable = s.Out + + // Compress using new table + s.Out, err = compressor(in) + if err != nil { + s.OutTable = nil + return nil, false, err + } + if len(s.Out) >= wantSize { + s.OutTable = nil + return nil, false, ErrIncompressible + } + // Move current table into previous. + s.prevTable, s.prevTableLog, s.cTable = s.cTable, s.actualTableLog, s.prevTable[:0] + s.OutData = s.Out[len(s.OutTable):] + return s.Out, false, nil +} + +// EstimateSizes will estimate the data sizes +func EstimateSizes(in []byte, s *Scratch) (tableSz, dataSz, reuseSz int, err error) { + s, err = s.prepare(in) + if err != nil { + return 0, 0, 0, err + } + + // Create histogram, if none was provided. + tableSz, dataSz, reuseSz = -1, -1, -1 + maxCount := s.maxCount + var canReuse = false + if maxCount == 0 { + maxCount, canReuse = s.countSimple(in) + } else { + canReuse = s.canUseTable(s.prevTable) + } + + // We want the output size to be less than this: + wantSize := len(in) + if s.WantLogLess > 0 { + wantSize -= wantSize >> s.WantLogLess + } + + // Reset for next run. + s.clearCount = true + s.maxCount = 0 + if maxCount >= len(in) { + if maxCount > len(in) { + return 0, 0, 0, fmt.Errorf("maxCount (%d) > length (%d)", maxCount, len(in)) + } + if len(in) == 1 { + return 0, 0, 0, ErrIncompressible + } + // One symbol, use RLE + return 0, 0, 0, ErrUseRLE + } + if maxCount == 1 || maxCount < (len(in)>>7) { + // Each symbol present maximum once or too well distributed. + return 0, 0, 0, ErrIncompressible + } + + // Calculate new table. + err = s.buildCTable() + if err != nil { + return 0, 0, 0, err + } + + if false && !s.canUseTable(s.cTable) { + panic("invalid table generated") + } + + tableSz, err = s.cTable.estTableSize(s) + if err != nil { + return 0, 0, 0, err + } + if canReuse { + reuseSz = s.prevTable.estimateSize(s.count[:s.symbolLen]) + } + dataSz = s.cTable.estimateSize(s.count[:s.symbolLen]) + + // Restore + return tableSz, dataSz, reuseSz, nil +} + +func (s *Scratch) compress1X(src []byte) ([]byte, error) { + return s.compress1xDo(s.Out, src) +} + +func (s *Scratch) compress1xDo(dst, src []byte) ([]byte, error) { + var bw = bitWriter{out: dst} + + // N is length divisible by 4. + n := len(src) + n -= n & 3 + cTable := s.cTable[:256] + + // Encode last bytes. + for i := len(src) & 3; i > 0; i-- { + bw.encSymbol(cTable, src[n+i-1]) + } + n -= 4 + if s.actualTableLog <= 8 { + for ; n >= 0; n -= 4 { + tmp := src[n : n+4] + // tmp should be len 4 + bw.flush32() + bw.encFourSymbols(cTable[tmp[3]], cTable[tmp[2]], cTable[tmp[1]], cTable[tmp[0]]) + } + } else { + for ; n >= 0; n -= 4 { + tmp := src[n : n+4] + // tmp should be len 4 + bw.flush32() + bw.encTwoSymbols(cTable, tmp[3], tmp[2]) + bw.flush32() + bw.encTwoSymbols(cTable, tmp[1], tmp[0]) + } + } + err := bw.close() + return bw.out, err +} + +var sixZeros [6]byte + +func (s *Scratch) compress4X(src []byte) ([]byte, error) { + if len(src) < 12 { + return nil, ErrIncompressible + } + segmentSize := (len(src) + 3) / 4 + + // Add placeholder for output length + offsetIdx := len(s.Out) + s.Out = append(s.Out, sixZeros[:]...) + + for i := 0; i < 4; i++ { + toDo := src + if len(toDo) > segmentSize { + toDo = toDo[:segmentSize] + } + src = src[len(toDo):] + + var err error + idx := len(s.Out) + s.Out, err = s.compress1xDo(s.Out, toDo) + if err != nil { + return nil, err + } + if len(s.Out)-idx > math.MaxUint16 { + // We cannot store the size in the jump table + return nil, ErrIncompressible + } + // Write compressed length as little endian before block. + if i < 3 { + // Last length is not written. + length := len(s.Out) - idx + s.Out[i*2+offsetIdx] = byte(length) + s.Out[i*2+offsetIdx+1] = byte(length >> 8) + } + } + + return s.Out, nil +} + +// compress4Xp will compress 4 streams using separate goroutines. +func (s *Scratch) compress4Xp(src []byte) ([]byte, error) { + if len(src) < 12 { + return nil, ErrIncompressible + } + // Add placeholder for output length + s.Out = s.Out[:6] + + segmentSize := (len(src) + 3) / 4 + var wg sync.WaitGroup + var errs [4]error + wg.Add(4) + for i := 0; i < 4; i++ { + toDo := src + if len(toDo) > segmentSize { + toDo = toDo[:segmentSize] + } + src = src[len(toDo):] + + // Separate goroutine for each block. + go func(i int) { + s.tmpOut[i], errs[i] = s.compress1xDo(s.tmpOut[i][:0], toDo) + wg.Done() + }(i) + } + wg.Wait() + for i := 0; i < 4; i++ { + if errs[i] != nil { + return nil, errs[i] + } + o := s.tmpOut[i] + if len(o) > math.MaxUint16 { + // We cannot store the size in the jump table + return nil, ErrIncompressible + } + // Write compressed length as little endian before block. + if i < 3 { + // Last length is not written. + s.Out[i*2] = byte(len(o)) + s.Out[i*2+1] = byte(len(o) >> 8) + } + + // Write output. + s.Out = append(s.Out, o...) + } + return s.Out, nil +} + +// countSimple will create a simple histogram in s.count. +// Returns the biggest count. +// Does not update s.clearCount. +func (s *Scratch) countSimple(in []byte) (max int, reuse bool) { + reuse = true + for _, v := range in { + s.count[v]++ + } + m := uint32(0) + if len(s.prevTable) > 0 { + for i, v := range s.count[:] { + if v == 0 { + continue + } + if v > m { + m = v + } + s.symbolLen = uint16(i) + 1 + if i >= len(s.prevTable) { + reuse = false + } else if s.prevTable[i].nBits == 0 { + reuse = false + } + } + return int(m), reuse + } + for i, v := range s.count[:] { + if v == 0 { + continue + } + if v > m { + m = v + } + s.symbolLen = uint16(i) + 1 + } + return int(m), false +} + +func (s *Scratch) canUseTable(c cTable) bool { + if len(c) < int(s.symbolLen) { + return false + } + for i, v := range s.count[:s.symbolLen] { + if v != 0 && c[i].nBits == 0 { + return false + } + } + return true +} + +//lint:ignore U1000 used for debugging +func (s *Scratch) validateTable(c cTable) bool { + if len(c) < int(s.symbolLen) { + return false + } + for i, v := range s.count[:s.symbolLen] { + if v != 0 { + if c[i].nBits == 0 { + return false + } + if c[i].nBits > s.actualTableLog { + return false + } + } + } + return true +} + +// minTableLog provides the minimum logSize to safely represent a distribution. +func (s *Scratch) minTableLog() uint8 { + minBitsSrc := highBit32(uint32(s.br.remain())) + 1 + minBitsSymbols := highBit32(uint32(s.symbolLen-1)) + 2 + if minBitsSrc < minBitsSymbols { + return uint8(minBitsSrc) + } + return uint8(minBitsSymbols) +} + +// optimalTableLog calculates and sets the optimal tableLog in s.actualTableLog +func (s *Scratch) optimalTableLog() { + tableLog := s.TableLog + minBits := s.minTableLog() + maxBitsSrc := uint8(highBit32(uint32(s.br.remain()-1))) - 1 + if maxBitsSrc < tableLog { + // Accuracy can be reduced + tableLog = maxBitsSrc + } + if minBits > tableLog { + tableLog = minBits + } + // Need a minimum to safely represent all symbol values + if tableLog < minTablelog { + tableLog = minTablelog + } + if tableLog > tableLogMax { + tableLog = tableLogMax + } + s.actualTableLog = tableLog +} + +type cTableEntry struct { + val uint16 + nBits uint8 + // We have 8 bits extra +} + +const huffNodesMask = huffNodesLen - 1 + +func (s *Scratch) buildCTable() error { + s.optimalTableLog() + s.huffSort() + if cap(s.cTable) < maxSymbolValue+1 { + s.cTable = make([]cTableEntry, s.symbolLen, maxSymbolValue+1) + } else { + s.cTable = s.cTable[:s.symbolLen] + for i := range s.cTable { + s.cTable[i] = cTableEntry{} + } + } + + var startNode = int16(s.symbolLen) + nonNullRank := s.symbolLen - 1 + + nodeNb := startNode + huffNode := s.nodes[1 : huffNodesLen+1] + + // This overlays the slice above, but allows "-1" index lookups. + // Different from reference implementation. + huffNode0 := s.nodes[0 : huffNodesLen+1] + + for huffNode[nonNullRank].count() == 0 { + nonNullRank-- + } + + lowS := int16(nonNullRank) + nodeRoot := nodeNb + lowS - 1 + lowN := nodeNb + huffNode[nodeNb].setCount(huffNode[lowS].count() + huffNode[lowS-1].count()) + huffNode[lowS].setParent(nodeNb) + huffNode[lowS-1].setParent(nodeNb) + nodeNb++ + lowS -= 2 + for n := nodeNb; n <= nodeRoot; n++ { + huffNode[n].setCount(1 << 30) + } + // fake entry, strong barrier + huffNode0[0].setCount(1 << 31) + + // create parents + for nodeNb <= nodeRoot { + var n1, n2 int16 + if huffNode0[lowS+1].count() < huffNode0[lowN+1].count() { + n1 = lowS + lowS-- + } else { + n1 = lowN + lowN++ + } + if huffNode0[lowS+1].count() < huffNode0[lowN+1].count() { + n2 = lowS + lowS-- + } else { + n2 = lowN + lowN++ + } + + huffNode[nodeNb].setCount(huffNode0[n1+1].count() + huffNode0[n2+1].count()) + huffNode0[n1+1].setParent(nodeNb) + huffNode0[n2+1].setParent(nodeNb) + nodeNb++ + } + + // distribute weights (unlimited tree height) + huffNode[nodeRoot].setNbBits(0) + for n := nodeRoot - 1; n >= startNode; n-- { + huffNode[n].setNbBits(huffNode[huffNode[n].parent()].nbBits() + 1) + } + for n := uint16(0); n <= nonNullRank; n++ { + huffNode[n].setNbBits(huffNode[huffNode[n].parent()].nbBits() + 1) + } + s.actualTableLog = s.setMaxHeight(int(nonNullRank)) + maxNbBits := s.actualTableLog + + // fill result into tree (val, nbBits) + if maxNbBits > tableLogMax { + return fmt.Errorf("internal error: maxNbBits (%d) > tableLogMax (%d)", maxNbBits, tableLogMax) + } + var nbPerRank [tableLogMax + 1]uint16 + var valPerRank [16]uint16 + for _, v := range huffNode[:nonNullRank+1] { + nbPerRank[v.nbBits()]++ + } + // determine stating value per rank + { + min := uint16(0) + for n := maxNbBits; n > 0; n-- { + // get starting value within each rank + valPerRank[n] = min + min += nbPerRank[n] + min >>= 1 + } + } + + // push nbBits per symbol, symbol order + for _, v := range huffNode[:nonNullRank+1] { + s.cTable[v.symbol()].nBits = v.nbBits() + } + + // assign value within rank, symbol order + t := s.cTable[:s.symbolLen] + for n, val := range t { + nbits := val.nBits & 15 + v := valPerRank[nbits] + t[n].val = v + valPerRank[nbits] = v + 1 + } + + return nil +} + +// huffSort will sort symbols, decreasing order. +func (s *Scratch) huffSort() { + type rankPos struct { + base uint32 + current uint32 + } + + // Clear nodes + nodes := s.nodes[:huffNodesLen+1] + s.nodes = nodes + nodes = nodes[1 : huffNodesLen+1] + + // Sort into buckets based on length of symbol count. + var rank [32]rankPos + for _, v := range s.count[:s.symbolLen] { + r := highBit32(v+1) & 31 + rank[r].base++ + } + // maxBitLength is log2(BlockSizeMax) + 1 + const maxBitLength = 18 + 1 + for n := maxBitLength; n > 0; n-- { + rank[n-1].base += rank[n].base + } + for n := range rank[:maxBitLength] { + rank[n].current = rank[n].base + } + for n, c := range s.count[:s.symbolLen] { + r := (highBit32(c+1) + 1) & 31 + pos := rank[r].current + rank[r].current++ + prev := nodes[(pos-1)&huffNodesMask] + for pos > rank[r].base && c > prev.count() { + nodes[pos&huffNodesMask] = prev + pos-- + prev = nodes[(pos-1)&huffNodesMask] + } + nodes[pos&huffNodesMask] = makeNodeElt(c, byte(n)) + } +} + +func (s *Scratch) setMaxHeight(lastNonNull int) uint8 { + maxNbBits := s.actualTableLog + huffNode := s.nodes[1 : huffNodesLen+1] + //huffNode = huffNode[: huffNodesLen] + + largestBits := huffNode[lastNonNull].nbBits() + + // early exit : no elt > maxNbBits + if largestBits <= maxNbBits { + return largestBits + } + totalCost := int(0) + baseCost := int(1) << (largestBits - maxNbBits) + n := uint32(lastNonNull) + + for huffNode[n].nbBits() > maxNbBits { + totalCost += baseCost - (1 << (largestBits - huffNode[n].nbBits())) + huffNode[n].setNbBits(maxNbBits) + n-- + } + // n stops at huffNode[n].nbBits <= maxNbBits + + for huffNode[n].nbBits() == maxNbBits { + n-- + } + // n end at index of smallest symbol using < maxNbBits + + // renorm totalCost + totalCost >>= largestBits - maxNbBits /* note : totalCost is necessarily a multiple of baseCost */ + + // repay normalized cost + { + const noSymbol = 0xF0F0F0F0 + var rankLast [tableLogMax + 2]uint32 + + for i := range rankLast[:] { + rankLast[i] = noSymbol + } + + // Get pos of last (smallest) symbol per rank + { + currentNbBits := maxNbBits + for pos := int(n); pos >= 0; pos-- { + if huffNode[pos].nbBits() >= currentNbBits { + continue + } + currentNbBits = huffNode[pos].nbBits() // < maxNbBits + rankLast[maxNbBits-currentNbBits] = uint32(pos) + } + } + + for totalCost > 0 { + nBitsToDecrease := uint8(highBit32(uint32(totalCost))) + 1 + + for ; nBitsToDecrease > 1; nBitsToDecrease-- { + highPos := rankLast[nBitsToDecrease] + lowPos := rankLast[nBitsToDecrease-1] + if highPos == noSymbol { + continue + } + if lowPos == noSymbol { + break + } + highTotal := huffNode[highPos].count() + lowTotal := 2 * huffNode[lowPos].count() + if highTotal <= lowTotal { + break + } + } + // only triggered when no more rank 1 symbol left => find closest one (note : there is necessarily at least one !) + // HUF_MAX_TABLELOG test just to please gcc 5+; but it should not be necessary + // FIXME: try to remove + for (nBitsToDecrease <= tableLogMax) && (rankLast[nBitsToDecrease] == noSymbol) { + nBitsToDecrease++ + } + totalCost -= 1 << (nBitsToDecrease - 1) + if rankLast[nBitsToDecrease-1] == noSymbol { + // this rank is no longer empty + rankLast[nBitsToDecrease-1] = rankLast[nBitsToDecrease] + } + huffNode[rankLast[nBitsToDecrease]].setNbBits(1 + + huffNode[rankLast[nBitsToDecrease]].nbBits()) + if rankLast[nBitsToDecrease] == 0 { + /* special case, reached largest symbol */ + rankLast[nBitsToDecrease] = noSymbol + } else { + rankLast[nBitsToDecrease]-- + if huffNode[rankLast[nBitsToDecrease]].nbBits() != maxNbBits-nBitsToDecrease { + rankLast[nBitsToDecrease] = noSymbol /* this rank is now empty */ + } + } + } + + for totalCost < 0 { /* Sometimes, cost correction overshoot */ + if rankLast[1] == noSymbol { /* special case : no rank 1 symbol (using maxNbBits-1); let's create one from largest rank 0 (using maxNbBits) */ + for huffNode[n].nbBits() == maxNbBits { + n-- + } + huffNode[n+1].setNbBits(huffNode[n+1].nbBits() - 1) + rankLast[1] = n + 1 + totalCost++ + continue + } + huffNode[rankLast[1]+1].setNbBits(huffNode[rankLast[1]+1].nbBits() - 1) + rankLast[1]++ + totalCost++ + } + } + return maxNbBits +} + +// A nodeElt is the fields +// +// count uint32 +// parent uint16 +// symbol byte +// nbBits uint8 +// +// in some order, all squashed into an integer so that the compiler +// always loads and stores entire nodeElts instead of separate fields. +type nodeElt uint64 + +func makeNodeElt(count uint32, symbol byte) nodeElt { + return nodeElt(count) | nodeElt(symbol)<<48 +} + +func (e *nodeElt) count() uint32 { return uint32(*e) } +func (e *nodeElt) parent() uint16 { return uint16(*e >> 32) } +func (e *nodeElt) symbol() byte { return byte(*e >> 48) } +func (e *nodeElt) nbBits() uint8 { return uint8(*e >> 56) } + +func (e *nodeElt) setCount(c uint32) { *e = (*e)&0xffffffff00000000 | nodeElt(c) } +func (e *nodeElt) setParent(p int16) { *e = (*e)&0xffff0000ffffffff | nodeElt(uint16(p))<<32 } +func (e *nodeElt) setNbBits(n uint8) { *e = (*e)&0x00ffffffffffffff | nodeElt(n)<<56 } diff --git a/vendor/github.com/klauspost/compress/huff0/decompress.go b/vendor/github.com/klauspost/compress/huff0/decompress.go new file mode 100644 index 000000000..54bd08b25 --- /dev/null +++ b/vendor/github.com/klauspost/compress/huff0/decompress.go @@ -0,0 +1,1167 @@ +package huff0 + +import ( + "errors" + "fmt" + "io" + "sync" + + "github.com/klauspost/compress/fse" +) + +type dTable struct { + single []dEntrySingle +} + +// single-symbols decoding +type dEntrySingle struct { + entry uint16 +} + +// Uses special code for all tables that are < 8 bits. +const use8BitTables = true + +// ReadTable will read a table from the input. +// The size of the input may be larger than the table definition. +// Any content remaining after the table definition will be returned. +// If no Scratch is provided a new one is allocated. +// The returned Scratch can be used for encoding or decoding input using this table. +func ReadTable(in []byte, s *Scratch) (s2 *Scratch, remain []byte, err error) { + s, err = s.prepare(nil) + if err != nil { + return s, nil, err + } + if len(in) <= 1 { + return s, nil, errors.New("input too small for table") + } + iSize := in[0] + in = in[1:] + if iSize >= 128 { + // Uncompressed + oSize := iSize - 127 + iSize = (oSize + 1) / 2 + if int(iSize) > len(in) { + return s, nil, errors.New("input too small for table") + } + for n := uint8(0); n < oSize; n += 2 { + v := in[n/2] + s.huffWeight[n] = v >> 4 + s.huffWeight[n+1] = v & 15 + } + s.symbolLen = uint16(oSize) + in = in[iSize:] + } else { + if len(in) < int(iSize) { + return s, nil, fmt.Errorf("input too small for table, want %d bytes, have %d", iSize, len(in)) + } + // FSE compressed weights + s.fse.DecompressLimit = 255 + hw := s.huffWeight[:] + s.fse.Out = hw + b, err := fse.Decompress(in[:iSize], s.fse) + s.fse.Out = nil + if err != nil { + return s, nil, fmt.Errorf("fse decompress returned: %w", err) + } + if len(b) > 255 { + return s, nil, errors.New("corrupt input: output table too large") + } + s.symbolLen = uint16(len(b)) + in = in[iSize:] + } + + // collect weight stats + var rankStats [16]uint32 + weightTotal := uint32(0) + for _, v := range s.huffWeight[:s.symbolLen] { + if v > tableLogMax { + return s, nil, errors.New("corrupt input: weight too large") + } + v2 := v & 15 + rankStats[v2]++ + // (1 << (v2-1)) is slower since the compiler cannot prove that v2 isn't 0. + weightTotal += (1 << v2) >> 1 + } + if weightTotal == 0 { + return s, nil, errors.New("corrupt input: weights zero") + } + + // get last non-null symbol weight (implied, total must be 2^n) + { + tableLog := highBit32(weightTotal) + 1 + if tableLog > tableLogMax { + return s, nil, errors.New("corrupt input: tableLog too big") + } + s.actualTableLog = uint8(tableLog) + // determine last weight + { + total := uint32(1) << tableLog + rest := total - weightTotal + verif := uint32(1) << highBit32(rest) + lastWeight := highBit32(rest) + 1 + if verif != rest { + // last value must be a clean power of 2 + return s, nil, errors.New("corrupt input: last value not power of two") + } + s.huffWeight[s.symbolLen] = uint8(lastWeight) + s.symbolLen++ + rankStats[lastWeight]++ + } + } + + if (rankStats[1] < 2) || (rankStats[1]&1 != 0) { + // by construction : at least 2 elts of rank 1, must be even + return s, nil, errors.New("corrupt input: min elt size, even check failed ") + } + + // TODO: Choose between single/double symbol decoding + + // Calculate starting value for each rank + { + var nextRankStart uint32 + for n := uint8(1); n < s.actualTableLog+1; n++ { + current := nextRankStart + nextRankStart += rankStats[n] << (n - 1) + rankStats[n] = current + } + } + + // fill DTable (always full size) + tSize := 1 << tableLogMax + if len(s.dt.single) != tSize { + s.dt.single = make([]dEntrySingle, tSize) + } + cTable := s.prevTable + if cap(cTable) < maxSymbolValue+1 { + cTable = make([]cTableEntry, 0, maxSymbolValue+1) + } + cTable = cTable[:maxSymbolValue+1] + s.prevTable = cTable[:s.symbolLen] + s.prevTableLog = s.actualTableLog + + for n, w := range s.huffWeight[:s.symbolLen] { + if w == 0 { + cTable[n] = cTableEntry{ + val: 0, + nBits: 0, + } + continue + } + length := (uint32(1) << w) >> 1 + d := dEntrySingle{ + entry: uint16(s.actualTableLog+1-w) | (uint16(n) << 8), + } + + rank := &rankStats[w] + cTable[n] = cTableEntry{ + val: uint16(*rank >> (w - 1)), + nBits: uint8(d.entry), + } + + single := s.dt.single[*rank : *rank+length] + for i := range single { + single[i] = d + } + *rank += length + } + + return s, in, nil +} + +// Decompress1X will decompress a 1X encoded stream. +// The length of the supplied input must match the end of a block exactly. +// Before this is called, the table must be initialized with ReadTable unless +// the encoder re-used the table. +// deprecated: Use the stateless Decoder() to get a concurrent version. +func (s *Scratch) Decompress1X(in []byte) (out []byte, err error) { + if cap(s.Out) < s.MaxDecodedSize { + s.Out = make([]byte, s.MaxDecodedSize) + } + s.Out = s.Out[:0:s.MaxDecodedSize] + s.Out, err = s.Decoder().Decompress1X(s.Out, in) + return s.Out, err +} + +// Decompress4X will decompress a 4X encoded stream. +// Before this is called, the table must be initialized with ReadTable unless +// the encoder re-used the table. +// The length of the supplied input must match the end of a block exactly. +// The destination size of the uncompressed data must be known and provided. +// deprecated: Use the stateless Decoder() to get a concurrent version. +func (s *Scratch) Decompress4X(in []byte, dstSize int) (out []byte, err error) { + if dstSize > s.MaxDecodedSize { + return nil, ErrMaxDecodedSizeExceeded + } + if cap(s.Out) < dstSize { + s.Out = make([]byte, s.MaxDecodedSize) + } + s.Out = s.Out[:0:dstSize] + s.Out, err = s.Decoder().Decompress4X(s.Out, in) + return s.Out, err +} + +// Decoder will return a stateless decoder that can be used by multiple +// decompressors concurrently. +// Before this is called, the table must be initialized with ReadTable. +// The Decoder is still linked to the scratch buffer so that cannot be reused. +// However, it is safe to discard the scratch. +func (s *Scratch) Decoder() *Decoder { + return &Decoder{ + dt: s.dt, + actualTableLog: s.actualTableLog, + bufs: &s.decPool, + } +} + +// Decoder provides stateless decoding. +type Decoder struct { + dt dTable + actualTableLog uint8 + bufs *sync.Pool +} + +func (d *Decoder) buffer() *[4][256]byte { + buf, ok := d.bufs.Get().(*[4][256]byte) + if ok { + return buf + } + return &[4][256]byte{} +} + +// decompress1X8Bit will decompress a 1X encoded stream with tablelog <= 8. +// The cap of the output buffer will be the maximum decompressed size. +// The length of the supplied input must match the end of a block exactly. +func (d *Decoder) decompress1X8Bit(dst, src []byte) ([]byte, error) { + if d.actualTableLog == 8 { + return d.decompress1X8BitExactly(dst, src) + } + var br bitReaderBytes + err := br.init(src) + if err != nil { + return dst, err + } + maxDecodedSize := cap(dst) + dst = dst[:0] + + // Avoid bounds check by always having full sized table. + dt := d.dt.single[:256] + + // Use temp table to avoid bound checks/append penalty. + bufs := d.buffer() + buf := &bufs[0] + var off uint8 + + switch d.actualTableLog { + case 8: + const shift = 0 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + br.close() + d.bufs.Put(bufs) + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + case 7: + const shift = 8 - 7 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + br.close() + d.bufs.Put(bufs) + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + case 6: + const shift = 8 - 6 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + case 5: + const shift = 8 - 5 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + case 4: + const shift = 8 - 4 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + case 3: + const shift = 8 - 3 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + case 2: + const shift = 8 - 2 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + case 1: + const shift = 8 - 1 + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>(56+shift))] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + default: + d.bufs.Put(bufs) + return nil, fmt.Errorf("invalid tablelog: %d", d.actualTableLog) + } + + if len(dst)+int(off) > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:off]...) + + // br < 4, so uint8 is fine + bitsLeft := int8(uint8(br.off)*8 + (64 - br.bitsRead)) + shift := (8 - d.actualTableLog) & 7 + + for bitsLeft > 0 { + if br.bitsRead >= 64-8 { + for br.off > 0 { + br.value |= uint64(br.in[br.off-1]) << (br.bitsRead - 8) + br.bitsRead -= 8 + br.off-- + } + } + if len(dst) >= maxDecodedSize { + br.close() + d.bufs.Put(bufs) + return nil, ErrMaxDecodedSizeExceeded + } + v := dt[br.peekByteFast()>>shift] + nBits := uint8(v.entry) + br.advance(nBits) + bitsLeft -= int8(nBits) + dst = append(dst, uint8(v.entry>>8)) + } + d.bufs.Put(bufs) + return dst, br.close() +} + +// decompress1X8Bit will decompress a 1X encoded stream with tablelog <= 8. +// The cap of the output buffer will be the maximum decompressed size. +// The length of the supplied input must match the end of a block exactly. +func (d *Decoder) decompress1X8BitExactly(dst, src []byte) ([]byte, error) { + var br bitReaderBytes + err := br.init(src) + if err != nil { + return dst, err + } + maxDecodedSize := cap(dst) + dst = dst[:0] + + // Avoid bounds check by always having full sized table. + dt := d.dt.single[:256] + + // Use temp table to avoid bound checks/append penalty. + bufs := d.buffer() + buf := &bufs[0] + var off uint8 + + const shift = 56 + + //fmt.Printf("mask: %b, tl:%d\n", mask, d.actualTableLog) + for br.off >= 4 { + br.fillFast() + v := dt[uint8(br.value>>shift)] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>shift)] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>shift)] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[uint8(br.value>>shift)] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + + if len(dst)+int(off) > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:off]...) + + // br < 4, so uint8 is fine + bitsLeft := int8(uint8(br.off)*8 + (64 - br.bitsRead)) + for bitsLeft > 0 { + if br.bitsRead >= 64-8 { + for br.off > 0 { + br.value |= uint64(br.in[br.off-1]) << (br.bitsRead - 8) + br.bitsRead -= 8 + br.off-- + } + } + if len(dst) >= maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + v := dt[br.peekByteFast()] + nBits := uint8(v.entry) + br.advance(nBits) + bitsLeft -= int8(nBits) + dst = append(dst, uint8(v.entry>>8)) + } + d.bufs.Put(bufs) + return dst, br.close() +} + +// Decompress4X will decompress a 4X encoded stream. +// The length of the supplied input must match the end of a block exactly. +// The *capacity* of the dst slice must match the destination size of +// the uncompressed data exactly. +func (d *Decoder) decompress4X8bit(dst, src []byte) ([]byte, error) { + if d.actualTableLog == 8 { + return d.decompress4X8bitExactly(dst, src) + } + + var br [4]bitReaderBytes + start := 6 + for i := 0; i < 3; i++ { + length := int(src[i*2]) | (int(src[i*2+1]) << 8) + if start+length >= len(src) { + return nil, errors.New("truncated input (or invalid offset)") + } + err := br[i].init(src[start : start+length]) + if err != nil { + return nil, err + } + start += length + } + err := br[3].init(src[start:]) + if err != nil { + return nil, err + } + + // destination, offset to match first output + dstSize := cap(dst) + dst = dst[:dstSize] + out := dst + dstEvery := (dstSize + 3) / 4 + + shift := (56 + (8 - d.actualTableLog)) & 63 + + const tlSize = 1 << 8 + single := d.dt.single[:tlSize] + + // Use temp table to avoid bound checks/append penalty. + buf := d.buffer() + var off uint8 + var decoded int + + // Decode 4 values from each decoder/loop. + const bufoff = 256 + for { + if br[0].off < 4 || br[1].off < 4 || br[2].off < 4 || br[3].off < 4 { + break + } + + { + // Interleave 2 decodes. + const stream = 0 + const stream2 = 1 + br1 := &br[stream] + br2 := &br[stream2] + br1.fillFast() + br2.fillFast() + + v := single[uint8(br1.value>>shift)].entry + v2 := single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off] = uint8(v >> 8) + buf[stream2][off] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+1] = uint8(v >> 8) + buf[stream2][off+1] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+2] = uint8(v >> 8) + buf[stream2][off+2] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+3] = uint8(v >> 8) + buf[stream2][off+3] = uint8(v2 >> 8) + } + + { + const stream = 2 + const stream2 = 3 + br1 := &br[stream] + br2 := &br[stream2] + br1.fillFast() + br2.fillFast() + + v := single[uint8(br1.value>>shift)].entry + v2 := single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off] = uint8(v >> 8) + buf[stream2][off] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+1] = uint8(v >> 8) + buf[stream2][off+1] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+2] = uint8(v >> 8) + buf[stream2][off+2] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+3] = uint8(v >> 8) + buf[stream2][off+3] = uint8(v2 >> 8) + } + + off += 4 + + if off == 0 { + if bufoff > dstEvery { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 1") + } + // There must at least be 3 buffers left. + if len(out)-bufoff < dstEvery*3 { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 2") + } + //copy(out, buf[0][:]) + //copy(out[dstEvery:], buf[1][:]) + //copy(out[dstEvery*2:], buf[2][:]) + *(*[bufoff]byte)(out) = buf[0] + *(*[bufoff]byte)(out[dstEvery:]) = buf[1] + *(*[bufoff]byte)(out[dstEvery*2:]) = buf[2] + *(*[bufoff]byte)(out[dstEvery*3:]) = buf[3] + out = out[bufoff:] + decoded += bufoff * 4 + } + } + if off > 0 { + ioff := int(off) + if len(out) < dstEvery*3+ioff { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 3") + } + copy(out, buf[0][:off]) + copy(out[dstEvery:], buf[1][:off]) + copy(out[dstEvery*2:], buf[2][:off]) + copy(out[dstEvery*3:], buf[3][:off]) + decoded += int(off) * 4 + out = out[off:] + } + + // Decode remaining. + // Decode remaining. + remainBytes := dstEvery - (decoded / 4) + for i := range br { + offset := dstEvery * i + endsAt := offset + remainBytes + if endsAt > len(out) { + endsAt = len(out) + } + br := &br[i] + bitsLeft := br.remaining() + for bitsLeft > 0 { + if br.finished() { + d.bufs.Put(buf) + return nil, io.ErrUnexpectedEOF + } + if br.bitsRead >= 56 { + if br.off >= 4 { + v := br.in[br.off-4:] + v = v[:4] + low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + br.value |= uint64(low) << (br.bitsRead - 32) + br.bitsRead -= 32 + br.off -= 4 + } else { + for br.off > 0 { + br.value |= uint64(br.in[br.off-1]) << (br.bitsRead - 8) + br.bitsRead -= 8 + br.off-- + } + } + } + // end inline... + if offset >= endsAt { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 4") + } + + // Read value and increment offset. + v := single[uint8(br.value>>shift)].entry + nBits := uint8(v) + br.advance(nBits) + bitsLeft -= uint(nBits) + out[offset] = uint8(v >> 8) + offset++ + } + if offset != endsAt { + d.bufs.Put(buf) + return nil, fmt.Errorf("corruption detected: short output block %d, end %d != %d", i, offset, endsAt) + } + decoded += offset - dstEvery*i + err = br.close() + if err != nil { + d.bufs.Put(buf) + return nil, err + } + } + d.bufs.Put(buf) + if dstSize != decoded { + return nil, errors.New("corruption detected: short output block") + } + return dst, nil +} + +// Decompress4X will decompress a 4X encoded stream. +// The length of the supplied input must match the end of a block exactly. +// The *capacity* of the dst slice must match the destination size of +// the uncompressed data exactly. +func (d *Decoder) decompress4X8bitExactly(dst, src []byte) ([]byte, error) { + var br [4]bitReaderBytes + start := 6 + for i := 0; i < 3; i++ { + length := int(src[i*2]) | (int(src[i*2+1]) << 8) + if start+length >= len(src) { + return nil, errors.New("truncated input (or invalid offset)") + } + err := br[i].init(src[start : start+length]) + if err != nil { + return nil, err + } + start += length + } + err := br[3].init(src[start:]) + if err != nil { + return nil, err + } + + // destination, offset to match first output + dstSize := cap(dst) + dst = dst[:dstSize] + out := dst + dstEvery := (dstSize + 3) / 4 + + const shift = 56 + const tlSize = 1 << 8 + single := d.dt.single[:tlSize] + + // Use temp table to avoid bound checks/append penalty. + buf := d.buffer() + var off uint8 + var decoded int + + // Decode 4 values from each decoder/loop. + const bufoff = 256 + for { + if br[0].off < 4 || br[1].off < 4 || br[2].off < 4 || br[3].off < 4 { + break + } + + { + // Interleave 2 decodes. + const stream = 0 + const stream2 = 1 + br1 := &br[stream] + br2 := &br[stream2] + br1.fillFast() + br2.fillFast() + + v := single[uint8(br1.value>>shift)].entry + v2 := single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off] = uint8(v >> 8) + buf[stream2][off] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+1] = uint8(v >> 8) + buf[stream2][off+1] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+2] = uint8(v >> 8) + buf[stream2][off+2] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+3] = uint8(v >> 8) + buf[stream2][off+3] = uint8(v2 >> 8) + } + + { + const stream = 2 + const stream2 = 3 + br1 := &br[stream] + br2 := &br[stream2] + br1.fillFast() + br2.fillFast() + + v := single[uint8(br1.value>>shift)].entry + v2 := single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off] = uint8(v >> 8) + buf[stream2][off] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+1] = uint8(v >> 8) + buf[stream2][off+1] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+2] = uint8(v >> 8) + buf[stream2][off+2] = uint8(v2 >> 8) + + v = single[uint8(br1.value>>shift)].entry + v2 = single[uint8(br2.value>>shift)].entry + br1.bitsRead += uint8(v) + br1.value <<= v & 63 + br2.bitsRead += uint8(v2) + br2.value <<= v2 & 63 + buf[stream][off+3] = uint8(v >> 8) + buf[stream2][off+3] = uint8(v2 >> 8) + } + + off += 4 + + if off == 0 { + if bufoff > dstEvery { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 1") + } + // There must at least be 3 buffers left. + if len(out)-bufoff < dstEvery*3 { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 2") + } + + //copy(out, buf[0][:]) + //copy(out[dstEvery:], buf[1][:]) + //copy(out[dstEvery*2:], buf[2][:]) + // copy(out[dstEvery*3:], buf[3][:]) + *(*[bufoff]byte)(out) = buf[0] + *(*[bufoff]byte)(out[dstEvery:]) = buf[1] + *(*[bufoff]byte)(out[dstEvery*2:]) = buf[2] + *(*[bufoff]byte)(out[dstEvery*3:]) = buf[3] + out = out[bufoff:] + decoded += bufoff * 4 + } + } + if off > 0 { + ioff := int(off) + if len(out) < dstEvery*3+ioff { + return nil, errors.New("corruption detected: stream overrun 3") + } + copy(out, buf[0][:off]) + copy(out[dstEvery:], buf[1][:off]) + copy(out[dstEvery*2:], buf[2][:off]) + copy(out[dstEvery*3:], buf[3][:off]) + decoded += int(off) * 4 + out = out[off:] + } + + // Decode remaining. + remainBytes := dstEvery - (decoded / 4) + for i := range br { + offset := dstEvery * i + endsAt := offset + remainBytes + if endsAt > len(out) { + endsAt = len(out) + } + br := &br[i] + bitsLeft := br.remaining() + for bitsLeft > 0 { + if br.finished() { + d.bufs.Put(buf) + return nil, io.ErrUnexpectedEOF + } + if br.bitsRead >= 56 { + if br.off >= 4 { + v := br.in[br.off-4:] + v = v[:4] + low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + br.value |= uint64(low) << (br.bitsRead - 32) + br.bitsRead -= 32 + br.off -= 4 + } else { + for br.off > 0 { + br.value |= uint64(br.in[br.off-1]) << (br.bitsRead - 8) + br.bitsRead -= 8 + br.off-- + } + } + } + // end inline... + if offset >= endsAt { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 4") + } + + // Read value and increment offset. + v := single[br.peekByteFast()].entry + nBits := uint8(v) + br.advance(nBits) + bitsLeft -= uint(nBits) + out[offset] = uint8(v >> 8) + offset++ + } + if offset != endsAt { + d.bufs.Put(buf) + return nil, fmt.Errorf("corruption detected: short output block %d, end %d != %d", i, offset, endsAt) + } + + decoded += offset - dstEvery*i + err = br.close() + if err != nil { + d.bufs.Put(buf) + return nil, err + } + } + d.bufs.Put(buf) + if dstSize != decoded { + return nil, errors.New("corruption detected: short output block") + } + return dst, nil +} + +// matches will compare a decoding table to a coding table. +// Errors are written to the writer. +// Nothing will be written if table is ok. +func (s *Scratch) matches(ct cTable, w io.Writer) { + if s == nil || len(s.dt.single) == 0 { + return + } + dt := s.dt.single[:1<>8) == byte(sym) { + fmt.Fprintf(w, "symbol %x has decoder, but no encoder\n", sym) + errs++ + break + } + } + if errs == 0 { + broken-- + } + continue + } + // Unused bits in input + ub := tablelog - enc.nBits + top := enc.val << ub + // decoder looks at top bits. + dec := dt[top] + if uint8(dec.entry) != enc.nBits { + fmt.Fprintf(w, "symbol 0x%x bit size mismatch (enc: %d, dec:%d).\n", sym, enc.nBits, uint8(dec.entry)) + errs++ + } + if uint8(dec.entry>>8) != uint8(sym) { + fmt.Fprintf(w, "symbol 0x%x decoder output mismatch (enc: %d, dec:%d).\n", sym, sym, uint8(dec.entry>>8)) + errs++ + } + if errs > 0 { + fmt.Fprintf(w, "%d errros in base, stopping\n", errs) + continue + } + // Ensure that all combinations are covered. + for i := uint16(0); i < (1 << ub); i++ { + vval := top | i + dec := dt[vval] + if uint8(dec.entry) != enc.nBits { + fmt.Fprintf(w, "symbol 0x%x bit size mismatch (enc: %d, dec:%d).\n", vval, enc.nBits, uint8(dec.entry)) + errs++ + } + if uint8(dec.entry>>8) != uint8(sym) { + fmt.Fprintf(w, "symbol 0x%x decoder output mismatch (enc: %d, dec:%d).\n", vval, sym, uint8(dec.entry>>8)) + errs++ + } + if errs > 20 { + fmt.Fprintf(w, "%d errros, stopping\n", errs) + break + } + } + if errs == 0 { + ok++ + broken-- + } + } + if broken > 0 { + fmt.Fprintf(w, "%d broken, %d ok\n", broken, ok) + } +} diff --git a/vendor/github.com/klauspost/compress/huff0/decompress_amd64.go b/vendor/github.com/klauspost/compress/huff0/decompress_amd64.go new file mode 100644 index 000000000..ba7e8e6b0 --- /dev/null +++ b/vendor/github.com/klauspost/compress/huff0/decompress_amd64.go @@ -0,0 +1,226 @@ +//go:build amd64 && !appengine && !noasm && gc +// +build amd64,!appengine,!noasm,gc + +// This file contains the specialisation of Decoder.Decompress4X +// and Decoder.Decompress1X that use an asm implementation of thir main loops. +package huff0 + +import ( + "errors" + "fmt" + + "github.com/klauspost/compress/internal/cpuinfo" +) + +// decompress4x_main_loop_x86 is an x86 assembler implementation +// of Decompress4X when tablelog > 8. +// +//go:noescape +func decompress4x_main_loop_amd64(ctx *decompress4xContext) + +// decompress4x_8b_loop_x86 is an x86 assembler implementation +// of Decompress4X when tablelog <= 8 which decodes 4 entries +// per loop. +// +//go:noescape +func decompress4x_8b_main_loop_amd64(ctx *decompress4xContext) + +// fallback8BitSize is the size where using Go version is faster. +const fallback8BitSize = 800 + +type decompress4xContext struct { + pbr *[4]bitReaderShifted + peekBits uint8 + out *byte + dstEvery int + tbl *dEntrySingle + decoded int + limit *byte +} + +// Decompress4X will decompress a 4X encoded stream. +// The length of the supplied input must match the end of a block exactly. +// The *capacity* of the dst slice must match the destination size of +// the uncompressed data exactly. +func (d *Decoder) Decompress4X(dst, src []byte) ([]byte, error) { + if len(d.dt.single) == 0 { + return nil, errors.New("no table loaded") + } + if len(src) < 6+(4*1) { + return nil, errors.New("input too small") + } + + use8BitTables := d.actualTableLog <= 8 + if cap(dst) < fallback8BitSize && use8BitTables { + return d.decompress4X8bit(dst, src) + } + + var br [4]bitReaderShifted + // Decode "jump table" + start := 6 + for i := 0; i < 3; i++ { + length := int(src[i*2]) | (int(src[i*2+1]) << 8) + if start+length >= len(src) { + return nil, errors.New("truncated input (or invalid offset)") + } + err := br[i].init(src[start : start+length]) + if err != nil { + return nil, err + } + start += length + } + err := br[3].init(src[start:]) + if err != nil { + return nil, err + } + + // destination, offset to match first output + dstSize := cap(dst) + dst = dst[:dstSize] + out := dst + dstEvery := (dstSize + 3) / 4 + + const tlSize = 1 << tableLogMax + const tlMask = tlSize - 1 + single := d.dt.single[:tlSize] + + var decoded int + + if len(out) > 4*4 && !(br[0].off < 4 || br[1].off < 4 || br[2].off < 4 || br[3].off < 4) { + ctx := decompress4xContext{ + pbr: &br, + peekBits: uint8((64 - d.actualTableLog) & 63), // see: bitReaderShifted.peekBitsFast() + out: &out[0], + dstEvery: dstEvery, + tbl: &single[0], + limit: &out[dstEvery-4], // Always stop decoding when first buffer gets here to avoid writing OOB on last. + } + if use8BitTables { + decompress4x_8b_main_loop_amd64(&ctx) + } else { + decompress4x_main_loop_amd64(&ctx) + } + + decoded = ctx.decoded + out = out[decoded/4:] + } + + // Decode remaining. + remainBytes := dstEvery - (decoded / 4) + for i := range br { + offset := dstEvery * i + endsAt := offset + remainBytes + if endsAt > len(out) { + endsAt = len(out) + } + br := &br[i] + bitsLeft := br.remaining() + for bitsLeft > 0 { + br.fill() + if offset >= endsAt { + return nil, errors.New("corruption detected: stream overrun 4") + } + + // Read value and increment offset. + val := br.peekBitsFast(d.actualTableLog) + v := single[val&tlMask].entry + nBits := uint8(v) + br.advance(nBits) + bitsLeft -= uint(nBits) + out[offset] = uint8(v >> 8) + offset++ + } + if offset != endsAt { + return nil, fmt.Errorf("corruption detected: short output block %d, end %d != %d", i, offset, endsAt) + } + decoded += offset - dstEvery*i + err = br.close() + if err != nil { + return nil, err + } + } + if dstSize != decoded { + return nil, errors.New("corruption detected: short output block") + } + return dst, nil +} + +// decompress4x_main_loop_x86 is an x86 assembler implementation +// of Decompress1X when tablelog > 8. +// +//go:noescape +func decompress1x_main_loop_amd64(ctx *decompress1xContext) + +// decompress4x_main_loop_x86 is an x86 with BMI2 assembler implementation +// of Decompress1X when tablelog > 8. +// +//go:noescape +func decompress1x_main_loop_bmi2(ctx *decompress1xContext) + +type decompress1xContext struct { + pbr *bitReaderShifted + peekBits uint8 + out *byte + outCap int + tbl *dEntrySingle + decoded int +} + +// Error reported by asm implementations +const error_max_decoded_size_exeeded = -1 + +// Decompress1X will decompress a 1X encoded stream. +// The cap of the output buffer will be the maximum decompressed size. +// The length of the supplied input must match the end of a block exactly. +func (d *Decoder) Decompress1X(dst, src []byte) ([]byte, error) { + if len(d.dt.single) == 0 { + return nil, errors.New("no table loaded") + } + var br bitReaderShifted + err := br.init(src) + if err != nil { + return dst, err + } + maxDecodedSize := cap(dst) + dst = dst[:maxDecodedSize] + + const tlSize = 1 << tableLogMax + const tlMask = tlSize - 1 + + if maxDecodedSize >= 4 { + ctx := decompress1xContext{ + pbr: &br, + out: &dst[0], + outCap: maxDecodedSize, + peekBits: uint8((64 - d.actualTableLog) & 63), // see: bitReaderShifted.peekBitsFast() + tbl: &d.dt.single[0], + } + + if cpuinfo.HasBMI2() { + decompress1x_main_loop_bmi2(&ctx) + } else { + decompress1x_main_loop_amd64(&ctx) + } + if ctx.decoded == error_max_decoded_size_exeeded { + return nil, ErrMaxDecodedSizeExceeded + } + + dst = dst[:ctx.decoded] + } + + // br < 8, so uint8 is fine + bitsLeft := uint8(br.off)*8 + 64 - br.bitsRead + for bitsLeft > 0 { + br.fill() + if len(dst) >= maxDecodedSize { + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + v := d.dt.single[br.peekBitsFast(d.actualTableLog)&tlMask] + nBits := uint8(v.entry) + br.advance(nBits) + bitsLeft -= nBits + dst = append(dst, uint8(v.entry>>8)) + } + return dst, br.close() +} diff --git a/vendor/github.com/klauspost/compress/huff0/decompress_amd64.s b/vendor/github.com/klauspost/compress/huff0/decompress_amd64.s new file mode 100644 index 000000000..c4c7ab2d1 --- /dev/null +++ b/vendor/github.com/klauspost/compress/huff0/decompress_amd64.s @@ -0,0 +1,830 @@ +// Code generated by command: go run gen.go -out ../decompress_amd64.s -pkg=huff0. DO NOT EDIT. + +//go:build amd64 && !appengine && !noasm && gc + +// func decompress4x_main_loop_amd64(ctx *decompress4xContext) +TEXT ·decompress4x_main_loop_amd64(SB), $0-8 + // Preload values + MOVQ ctx+0(FP), AX + MOVBQZX 8(AX), DI + MOVQ 16(AX), BX + MOVQ 48(AX), SI + MOVQ 24(AX), R8 + MOVQ 32(AX), R9 + MOVQ (AX), R10 + + // Main loop +main_loop: + XORL DX, DX + CMPQ BX, SI + SETGE DL + + // br0.fillFast32() + MOVQ 32(R10), R11 + MOVBQZX 40(R10), R12 + CMPQ R12, $0x20 + JBE skip_fill0 + MOVQ 24(R10), AX + SUBQ $0x20, R12 + SUBQ $0x04, AX + MOVQ (R10), R13 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (AX)(R13*1), R13 + MOVQ R12, CX + SHLQ CL, R13 + MOVQ AX, 24(R10) + ORQ R13, R11 + + // exhausted += (br0.off < 4) + CMPQ AX, $0x04 + ADCB $+0, DL + +skip_fill0: + // val0 := br0.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v0 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br0.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R11 + ADDB CL, R12 + + // val1 := br0.peekTopBits(peekBits) + MOVQ DI, CX + MOVQ R11, R13 + SHRQ CL, R13 + + // v1 := table[val1&mask] + MOVW (R9)(R13*2), CX + + // br0.advance(uint8(v1.entry)) + MOVB CH, AH + SHLQ CL, R11 + ADDB CL, R12 + + // these two writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + MOVW AX, (BX) + + // update the bitreader structure + MOVQ R11, 32(R10) + MOVB R12, 40(R10) + + // br1.fillFast32() + MOVQ 80(R10), R11 + MOVBQZX 88(R10), R12 + CMPQ R12, $0x20 + JBE skip_fill1 + MOVQ 72(R10), AX + SUBQ $0x20, R12 + SUBQ $0x04, AX + MOVQ 48(R10), R13 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (AX)(R13*1), R13 + MOVQ R12, CX + SHLQ CL, R13 + MOVQ AX, 72(R10) + ORQ R13, R11 + + // exhausted += (br1.off < 4) + CMPQ AX, $0x04 + ADCB $+0, DL + +skip_fill1: + // val0 := br1.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v0 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br1.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R11 + ADDB CL, R12 + + // val1 := br1.peekTopBits(peekBits) + MOVQ DI, CX + MOVQ R11, R13 + SHRQ CL, R13 + + // v1 := table[val1&mask] + MOVW (R9)(R13*2), CX + + // br1.advance(uint8(v1.entry)) + MOVB CH, AH + SHLQ CL, R11 + ADDB CL, R12 + + // these two writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + MOVW AX, (BX)(R8*1) + + // update the bitreader structure + MOVQ R11, 80(R10) + MOVB R12, 88(R10) + + // br2.fillFast32() + MOVQ 128(R10), R11 + MOVBQZX 136(R10), R12 + CMPQ R12, $0x20 + JBE skip_fill2 + MOVQ 120(R10), AX + SUBQ $0x20, R12 + SUBQ $0x04, AX + MOVQ 96(R10), R13 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (AX)(R13*1), R13 + MOVQ R12, CX + SHLQ CL, R13 + MOVQ AX, 120(R10) + ORQ R13, R11 + + // exhausted += (br2.off < 4) + CMPQ AX, $0x04 + ADCB $+0, DL + +skip_fill2: + // val0 := br2.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v0 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br2.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R11 + ADDB CL, R12 + + // val1 := br2.peekTopBits(peekBits) + MOVQ DI, CX + MOVQ R11, R13 + SHRQ CL, R13 + + // v1 := table[val1&mask] + MOVW (R9)(R13*2), CX + + // br2.advance(uint8(v1.entry)) + MOVB CH, AH + SHLQ CL, R11 + ADDB CL, R12 + + // these two writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + MOVW AX, (BX)(R8*2) + + // update the bitreader structure + MOVQ R11, 128(R10) + MOVB R12, 136(R10) + + // br3.fillFast32() + MOVQ 176(R10), R11 + MOVBQZX 184(R10), R12 + CMPQ R12, $0x20 + JBE skip_fill3 + MOVQ 168(R10), AX + SUBQ $0x20, R12 + SUBQ $0x04, AX + MOVQ 144(R10), R13 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (AX)(R13*1), R13 + MOVQ R12, CX + SHLQ CL, R13 + MOVQ AX, 168(R10) + ORQ R13, R11 + + // exhausted += (br3.off < 4) + CMPQ AX, $0x04 + ADCB $+0, DL + +skip_fill3: + // val0 := br3.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v0 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br3.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R11 + ADDB CL, R12 + + // val1 := br3.peekTopBits(peekBits) + MOVQ DI, CX + MOVQ R11, R13 + SHRQ CL, R13 + + // v1 := table[val1&mask] + MOVW (R9)(R13*2), CX + + // br3.advance(uint8(v1.entry)) + MOVB CH, AH + SHLQ CL, R11 + ADDB CL, R12 + + // these two writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + LEAQ (R8)(R8*2), CX + MOVW AX, (BX)(CX*1) + + // update the bitreader structure + MOVQ R11, 176(R10) + MOVB R12, 184(R10) + ADDQ $0x02, BX + TESTB DL, DL + JZ main_loop + MOVQ ctx+0(FP), AX + SUBQ 16(AX), BX + SHLQ $0x02, BX + MOVQ BX, 40(AX) + RET + +// func decompress4x_8b_main_loop_amd64(ctx *decompress4xContext) +TEXT ·decompress4x_8b_main_loop_amd64(SB), $0-8 + // Preload values + MOVQ ctx+0(FP), CX + MOVBQZX 8(CX), DI + MOVQ 16(CX), BX + MOVQ 48(CX), SI + MOVQ 24(CX), R8 + MOVQ 32(CX), R9 + MOVQ (CX), R10 + + // Main loop +main_loop: + XORL DX, DX + CMPQ BX, SI + SETGE DL + + // br0.fillFast32() + MOVQ 32(R10), R11 + MOVBQZX 40(R10), R12 + CMPQ R12, $0x20 + JBE skip_fill0 + MOVQ 24(R10), R13 + SUBQ $0x20, R12 + SUBQ $0x04, R13 + MOVQ (R10), R14 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (R13)(R14*1), R14 + MOVQ R12, CX + SHLQ CL, R14 + MOVQ R13, 24(R10) + ORQ R14, R11 + + // exhausted += (br0.off < 4) + CMPQ R13, $0x04 + ADCB $+0, DL + +skip_fill0: + // val0 := br0.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v0 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br0.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R11 + ADDB CL, R12 + + // val1 := br0.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v1 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br0.advance(uint8(v1.entry) + MOVB CH, AH + SHLQ CL, R11 + ADDB CL, R12 + BSWAPL AX + + // val2 := br0.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v2 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br0.advance(uint8(v2.entry) + MOVB CH, AH + SHLQ CL, R11 + ADDB CL, R12 + + // val3 := br0.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v3 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br0.advance(uint8(v3.entry) + MOVB CH, AL + SHLQ CL, R11 + ADDB CL, R12 + BSWAPL AX + + // these four writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + // out[id * dstEvery + 3] = uint8(v2.entry >> 8) + // out[id * dstEvery + 4] = uint8(v3.entry >> 8) + MOVL AX, (BX) + + // update the bitreader structure + MOVQ R11, 32(R10) + MOVB R12, 40(R10) + + // br1.fillFast32() + MOVQ 80(R10), R11 + MOVBQZX 88(R10), R12 + CMPQ R12, $0x20 + JBE skip_fill1 + MOVQ 72(R10), R13 + SUBQ $0x20, R12 + SUBQ $0x04, R13 + MOVQ 48(R10), R14 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (R13)(R14*1), R14 + MOVQ R12, CX + SHLQ CL, R14 + MOVQ R13, 72(R10) + ORQ R14, R11 + + // exhausted += (br1.off < 4) + CMPQ R13, $0x04 + ADCB $+0, DL + +skip_fill1: + // val0 := br1.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v0 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br1.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R11 + ADDB CL, R12 + + // val1 := br1.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v1 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br1.advance(uint8(v1.entry) + MOVB CH, AH + SHLQ CL, R11 + ADDB CL, R12 + BSWAPL AX + + // val2 := br1.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v2 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br1.advance(uint8(v2.entry) + MOVB CH, AH + SHLQ CL, R11 + ADDB CL, R12 + + // val3 := br1.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v3 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br1.advance(uint8(v3.entry) + MOVB CH, AL + SHLQ CL, R11 + ADDB CL, R12 + BSWAPL AX + + // these four writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + // out[id * dstEvery + 3] = uint8(v2.entry >> 8) + // out[id * dstEvery + 4] = uint8(v3.entry >> 8) + MOVL AX, (BX)(R8*1) + + // update the bitreader structure + MOVQ R11, 80(R10) + MOVB R12, 88(R10) + + // br2.fillFast32() + MOVQ 128(R10), R11 + MOVBQZX 136(R10), R12 + CMPQ R12, $0x20 + JBE skip_fill2 + MOVQ 120(R10), R13 + SUBQ $0x20, R12 + SUBQ $0x04, R13 + MOVQ 96(R10), R14 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (R13)(R14*1), R14 + MOVQ R12, CX + SHLQ CL, R14 + MOVQ R13, 120(R10) + ORQ R14, R11 + + // exhausted += (br2.off < 4) + CMPQ R13, $0x04 + ADCB $+0, DL + +skip_fill2: + // val0 := br2.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v0 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br2.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R11 + ADDB CL, R12 + + // val1 := br2.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v1 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br2.advance(uint8(v1.entry) + MOVB CH, AH + SHLQ CL, R11 + ADDB CL, R12 + BSWAPL AX + + // val2 := br2.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v2 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br2.advance(uint8(v2.entry) + MOVB CH, AH + SHLQ CL, R11 + ADDB CL, R12 + + // val3 := br2.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v3 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br2.advance(uint8(v3.entry) + MOVB CH, AL + SHLQ CL, R11 + ADDB CL, R12 + BSWAPL AX + + // these four writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + // out[id * dstEvery + 3] = uint8(v2.entry >> 8) + // out[id * dstEvery + 4] = uint8(v3.entry >> 8) + MOVL AX, (BX)(R8*2) + + // update the bitreader structure + MOVQ R11, 128(R10) + MOVB R12, 136(R10) + + // br3.fillFast32() + MOVQ 176(R10), R11 + MOVBQZX 184(R10), R12 + CMPQ R12, $0x20 + JBE skip_fill3 + MOVQ 168(R10), R13 + SUBQ $0x20, R12 + SUBQ $0x04, R13 + MOVQ 144(R10), R14 + + // b.value |= uint64(low) << (b.bitsRead & 63) + MOVL (R13)(R14*1), R14 + MOVQ R12, CX + SHLQ CL, R14 + MOVQ R13, 168(R10) + ORQ R14, R11 + + // exhausted += (br3.off < 4) + CMPQ R13, $0x04 + ADCB $+0, DL + +skip_fill3: + // val0 := br3.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v0 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br3.advance(uint8(v0.entry) + MOVB CH, AL + SHLQ CL, R11 + ADDB CL, R12 + + // val1 := br3.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v1 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br3.advance(uint8(v1.entry) + MOVB CH, AH + SHLQ CL, R11 + ADDB CL, R12 + BSWAPL AX + + // val2 := br3.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v2 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br3.advance(uint8(v2.entry) + MOVB CH, AH + SHLQ CL, R11 + ADDB CL, R12 + + // val3 := br3.peekTopBits(peekBits) + MOVQ R11, R13 + MOVQ DI, CX + SHRQ CL, R13 + + // v3 := table[val0&mask] + MOVW (R9)(R13*2), CX + + // br3.advance(uint8(v3.entry) + MOVB CH, AL + SHLQ CL, R11 + ADDB CL, R12 + BSWAPL AX + + // these four writes get coalesced + // out[id * dstEvery + 0] = uint8(v0.entry >> 8) + // out[id * dstEvery + 1] = uint8(v1.entry >> 8) + // out[id * dstEvery + 3] = uint8(v2.entry >> 8) + // out[id * dstEvery + 4] = uint8(v3.entry >> 8) + LEAQ (R8)(R8*2), CX + MOVL AX, (BX)(CX*1) + + // update the bitreader structure + MOVQ R11, 176(R10) + MOVB R12, 184(R10) + ADDQ $0x04, BX + TESTB DL, DL + JZ main_loop + MOVQ ctx+0(FP), AX + SUBQ 16(AX), BX + SHLQ $0x02, BX + MOVQ BX, 40(AX) + RET + +// func decompress1x_main_loop_amd64(ctx *decompress1xContext) +TEXT ·decompress1x_main_loop_amd64(SB), $0-8 + MOVQ ctx+0(FP), CX + MOVQ 16(CX), DX + MOVQ 24(CX), BX + CMPQ BX, $0x04 + JB error_max_decoded_size_exceeded + LEAQ (DX)(BX*1), BX + MOVQ (CX), SI + MOVQ (SI), R8 + MOVQ 24(SI), R9 + MOVQ 32(SI), R10 + MOVBQZX 40(SI), R11 + MOVQ 32(CX), SI + MOVBQZX 8(CX), DI + JMP loop_condition + +main_loop: + // Check if we have room for 4 bytes in the output buffer + LEAQ 4(DX), CX + CMPQ CX, BX + JGE error_max_decoded_size_exceeded + + // Decode 4 values + CMPQ R11, $0x20 + JL bitReader_fillFast_1_end + SUBQ $0x20, R11 + SUBQ $0x04, R9 + MOVL (R8)(R9*1), R12 + MOVQ R11, CX + SHLQ CL, R12 + ORQ R12, R10 + +bitReader_fillFast_1_end: + MOVQ DI, CX + MOVQ R10, R12 + SHRQ CL, R12 + MOVW (SI)(R12*2), CX + MOVB CH, AL + MOVBQZX CL, CX + ADDQ CX, R11 + SHLQ CL, R10 + MOVQ DI, CX + MOVQ R10, R12 + SHRQ CL, R12 + MOVW (SI)(R12*2), CX + MOVB CH, AH + MOVBQZX CL, CX + ADDQ CX, R11 + SHLQ CL, R10 + BSWAPL AX + CMPQ R11, $0x20 + JL bitReader_fillFast_2_end + SUBQ $0x20, R11 + SUBQ $0x04, R9 + MOVL (R8)(R9*1), R12 + MOVQ R11, CX + SHLQ CL, R12 + ORQ R12, R10 + +bitReader_fillFast_2_end: + MOVQ DI, CX + MOVQ R10, R12 + SHRQ CL, R12 + MOVW (SI)(R12*2), CX + MOVB CH, AH + MOVBQZX CL, CX + ADDQ CX, R11 + SHLQ CL, R10 + MOVQ DI, CX + MOVQ R10, R12 + SHRQ CL, R12 + MOVW (SI)(R12*2), CX + MOVB CH, AL + MOVBQZX CL, CX + ADDQ CX, R11 + SHLQ CL, R10 + BSWAPL AX + + // Store the decoded values + MOVL AX, (DX) + ADDQ $0x04, DX + +loop_condition: + CMPQ R9, $0x08 + JGE main_loop + + // Update ctx structure + MOVQ ctx+0(FP), AX + SUBQ 16(AX), DX + MOVQ DX, 40(AX) + MOVQ (AX), AX + MOVQ R9, 24(AX) + MOVQ R10, 32(AX) + MOVB R11, 40(AX) + RET + + // Report error +error_max_decoded_size_exceeded: + MOVQ ctx+0(FP), AX + MOVQ $-1, CX + MOVQ CX, 40(AX) + RET + +// func decompress1x_main_loop_bmi2(ctx *decompress1xContext) +// Requires: BMI2 +TEXT ·decompress1x_main_loop_bmi2(SB), $0-8 + MOVQ ctx+0(FP), CX + MOVQ 16(CX), DX + MOVQ 24(CX), BX + CMPQ BX, $0x04 + JB error_max_decoded_size_exceeded + LEAQ (DX)(BX*1), BX + MOVQ (CX), SI + MOVQ (SI), R8 + MOVQ 24(SI), R9 + MOVQ 32(SI), R10 + MOVBQZX 40(SI), R11 + MOVQ 32(CX), SI + MOVBQZX 8(CX), DI + JMP loop_condition + +main_loop: + // Check if we have room for 4 bytes in the output buffer + LEAQ 4(DX), CX + CMPQ CX, BX + JGE error_max_decoded_size_exceeded + + // Decode 4 values + CMPQ R11, $0x20 + JL bitReader_fillFast_1_end + SUBQ $0x20, R11 + SUBQ $0x04, R9 + MOVL (R8)(R9*1), CX + SHLXQ R11, CX, CX + ORQ CX, R10 + +bitReader_fillFast_1_end: + SHRXQ DI, R10, CX + MOVW (SI)(CX*2), CX + MOVB CH, AL + MOVBQZX CL, CX + ADDQ CX, R11 + SHLXQ CX, R10, R10 + SHRXQ DI, R10, CX + MOVW (SI)(CX*2), CX + MOVB CH, AH + MOVBQZX CL, CX + ADDQ CX, R11 + SHLXQ CX, R10, R10 + BSWAPL AX + CMPQ R11, $0x20 + JL bitReader_fillFast_2_end + SUBQ $0x20, R11 + SUBQ $0x04, R9 + MOVL (R8)(R9*1), CX + SHLXQ R11, CX, CX + ORQ CX, R10 + +bitReader_fillFast_2_end: + SHRXQ DI, R10, CX + MOVW (SI)(CX*2), CX + MOVB CH, AH + MOVBQZX CL, CX + ADDQ CX, R11 + SHLXQ CX, R10, R10 + SHRXQ DI, R10, CX + MOVW (SI)(CX*2), CX + MOVB CH, AL + MOVBQZX CL, CX + ADDQ CX, R11 + SHLXQ CX, R10, R10 + BSWAPL AX + + // Store the decoded values + MOVL AX, (DX) + ADDQ $0x04, DX + +loop_condition: + CMPQ R9, $0x08 + JGE main_loop + + // Update ctx structure + MOVQ ctx+0(FP), AX + SUBQ 16(AX), DX + MOVQ DX, 40(AX) + MOVQ (AX), AX + MOVQ R9, 24(AX) + MOVQ R10, 32(AX) + MOVB R11, 40(AX) + RET + + // Report error +error_max_decoded_size_exceeded: + MOVQ ctx+0(FP), AX + MOVQ $-1, CX + MOVQ CX, 40(AX) + RET diff --git a/vendor/github.com/klauspost/compress/huff0/decompress_generic.go b/vendor/github.com/klauspost/compress/huff0/decompress_generic.go new file mode 100644 index 000000000..908c17de6 --- /dev/null +++ b/vendor/github.com/klauspost/compress/huff0/decompress_generic.go @@ -0,0 +1,299 @@ +//go:build !amd64 || appengine || !gc || noasm +// +build !amd64 appengine !gc noasm + +// This file contains a generic implementation of Decoder.Decompress4X. +package huff0 + +import ( + "errors" + "fmt" +) + +// Decompress4X will decompress a 4X encoded stream. +// The length of the supplied input must match the end of a block exactly. +// The *capacity* of the dst slice must match the destination size of +// the uncompressed data exactly. +func (d *Decoder) Decompress4X(dst, src []byte) ([]byte, error) { + if len(d.dt.single) == 0 { + return nil, errors.New("no table loaded") + } + if len(src) < 6+(4*1) { + return nil, errors.New("input too small") + } + if use8BitTables && d.actualTableLog <= 8 { + return d.decompress4X8bit(dst, src) + } + + var br [4]bitReaderShifted + // Decode "jump table" + start := 6 + for i := 0; i < 3; i++ { + length := int(src[i*2]) | (int(src[i*2+1]) << 8) + if start+length >= len(src) { + return nil, errors.New("truncated input (or invalid offset)") + } + err := br[i].init(src[start : start+length]) + if err != nil { + return nil, err + } + start += length + } + err := br[3].init(src[start:]) + if err != nil { + return nil, err + } + + // destination, offset to match first output + dstSize := cap(dst) + dst = dst[:dstSize] + out := dst + dstEvery := (dstSize + 3) / 4 + + const tlSize = 1 << tableLogMax + const tlMask = tlSize - 1 + single := d.dt.single[:tlSize] + + // Use temp table to avoid bound checks/append penalty. + buf := d.buffer() + var off uint8 + var decoded int + + // Decode 2 values from each decoder/loop. + const bufoff = 256 + for { + if br[0].off < 4 || br[1].off < 4 || br[2].off < 4 || br[3].off < 4 { + break + } + + { + const stream = 0 + const stream2 = 1 + br[stream].fillFast() + br[stream2].fillFast() + + val := br[stream].peekBitsFast(d.actualTableLog) + val2 := br[stream2].peekBitsFast(d.actualTableLog) + v := single[val&tlMask] + v2 := single[val2&tlMask] + br[stream].advance(uint8(v.entry)) + br[stream2].advance(uint8(v2.entry)) + buf[stream][off] = uint8(v.entry >> 8) + buf[stream2][off] = uint8(v2.entry >> 8) + + val = br[stream].peekBitsFast(d.actualTableLog) + val2 = br[stream2].peekBitsFast(d.actualTableLog) + v = single[val&tlMask] + v2 = single[val2&tlMask] + br[stream].advance(uint8(v.entry)) + br[stream2].advance(uint8(v2.entry)) + buf[stream][off+1] = uint8(v.entry >> 8) + buf[stream2][off+1] = uint8(v2.entry >> 8) + } + + { + const stream = 2 + const stream2 = 3 + br[stream].fillFast() + br[stream2].fillFast() + + val := br[stream].peekBitsFast(d.actualTableLog) + val2 := br[stream2].peekBitsFast(d.actualTableLog) + v := single[val&tlMask] + v2 := single[val2&tlMask] + br[stream].advance(uint8(v.entry)) + br[stream2].advance(uint8(v2.entry)) + buf[stream][off] = uint8(v.entry >> 8) + buf[stream2][off] = uint8(v2.entry >> 8) + + val = br[stream].peekBitsFast(d.actualTableLog) + val2 = br[stream2].peekBitsFast(d.actualTableLog) + v = single[val&tlMask] + v2 = single[val2&tlMask] + br[stream].advance(uint8(v.entry)) + br[stream2].advance(uint8(v2.entry)) + buf[stream][off+1] = uint8(v.entry >> 8) + buf[stream2][off+1] = uint8(v2.entry >> 8) + } + + off += 2 + + if off == 0 { + if bufoff > dstEvery { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 1") + } + // There must at least be 3 buffers left. + if len(out)-bufoff < dstEvery*3 { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 2") + } + //copy(out, buf[0][:]) + //copy(out[dstEvery:], buf[1][:]) + //copy(out[dstEvery*2:], buf[2][:]) + //copy(out[dstEvery*3:], buf[3][:]) + *(*[bufoff]byte)(out) = buf[0] + *(*[bufoff]byte)(out[dstEvery:]) = buf[1] + *(*[bufoff]byte)(out[dstEvery*2:]) = buf[2] + *(*[bufoff]byte)(out[dstEvery*3:]) = buf[3] + out = out[bufoff:] + decoded += bufoff * 4 + } + } + if off > 0 { + ioff := int(off) + if len(out) < dstEvery*3+ioff { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 3") + } + copy(out, buf[0][:off]) + copy(out[dstEvery:], buf[1][:off]) + copy(out[dstEvery*2:], buf[2][:off]) + copy(out[dstEvery*3:], buf[3][:off]) + decoded += int(off) * 4 + out = out[off:] + } + + // Decode remaining. + remainBytes := dstEvery - (decoded / 4) + for i := range br { + offset := dstEvery * i + endsAt := offset + remainBytes + if endsAt > len(out) { + endsAt = len(out) + } + br := &br[i] + bitsLeft := br.remaining() + for bitsLeft > 0 { + br.fill() + if offset >= endsAt { + d.bufs.Put(buf) + return nil, errors.New("corruption detected: stream overrun 4") + } + + // Read value and increment offset. + val := br.peekBitsFast(d.actualTableLog) + v := single[val&tlMask].entry + nBits := uint8(v) + br.advance(nBits) + bitsLeft -= uint(nBits) + out[offset] = uint8(v >> 8) + offset++ + } + if offset != endsAt { + d.bufs.Put(buf) + return nil, fmt.Errorf("corruption detected: short output block %d, end %d != %d", i, offset, endsAt) + } + decoded += offset - dstEvery*i + err = br.close() + if err != nil { + return nil, err + } + } + d.bufs.Put(buf) + if dstSize != decoded { + return nil, errors.New("corruption detected: short output block") + } + return dst, nil +} + +// Decompress1X will decompress a 1X encoded stream. +// The cap of the output buffer will be the maximum decompressed size. +// The length of the supplied input must match the end of a block exactly. +func (d *Decoder) Decompress1X(dst, src []byte) ([]byte, error) { + if len(d.dt.single) == 0 { + return nil, errors.New("no table loaded") + } + if use8BitTables && d.actualTableLog <= 8 { + return d.decompress1X8Bit(dst, src) + } + var br bitReaderShifted + err := br.init(src) + if err != nil { + return dst, err + } + maxDecodedSize := cap(dst) + dst = dst[:0] + + // Avoid bounds check by always having full sized table. + const tlSize = 1 << tableLogMax + const tlMask = tlSize - 1 + dt := d.dt.single[:tlSize] + + // Use temp table to avoid bound checks/append penalty. + bufs := d.buffer() + buf := &bufs[0] + var off uint8 + + for br.off >= 8 { + br.fillFast() + v := dt[br.peekBitsFast(d.actualTableLog)&tlMask] + br.advance(uint8(v.entry)) + buf[off+0] = uint8(v.entry >> 8) + + v = dt[br.peekBitsFast(d.actualTableLog)&tlMask] + br.advance(uint8(v.entry)) + buf[off+1] = uint8(v.entry >> 8) + + // Refill + br.fillFast() + + v = dt[br.peekBitsFast(d.actualTableLog)&tlMask] + br.advance(uint8(v.entry)) + buf[off+2] = uint8(v.entry >> 8) + + v = dt[br.peekBitsFast(d.actualTableLog)&tlMask] + br.advance(uint8(v.entry)) + buf[off+3] = uint8(v.entry >> 8) + + off += 4 + if off == 0 { + if len(dst)+256 > maxDecodedSize { + br.close() + d.bufs.Put(bufs) + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:]...) + } + } + + if len(dst)+int(off) > maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + dst = append(dst, buf[:off]...) + + // br < 8, so uint8 is fine + bitsLeft := uint8(br.off)*8 + 64 - br.bitsRead + for bitsLeft > 0 { + br.fill() + if false && br.bitsRead >= 32 { + if br.off >= 4 { + v := br.in[br.off-4:] + v = v[:4] + low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + br.value = (br.value << 32) | uint64(low) + br.bitsRead -= 32 + br.off -= 4 + } else { + for br.off > 0 { + br.value = (br.value << 8) | uint64(br.in[br.off-1]) + br.bitsRead -= 8 + br.off-- + } + } + } + if len(dst) >= maxDecodedSize { + d.bufs.Put(bufs) + br.close() + return nil, ErrMaxDecodedSizeExceeded + } + v := d.dt.single[br.peekBitsFast(d.actualTableLog)&tlMask] + nBits := uint8(v.entry) + br.advance(nBits) + bitsLeft -= nBits + dst = append(dst, uint8(v.entry>>8)) + } + d.bufs.Put(bufs) + return dst, br.close() +} diff --git a/vendor/github.com/klauspost/compress/huff0/huff0.go b/vendor/github.com/klauspost/compress/huff0/huff0.go new file mode 100644 index 000000000..e8ad17ad0 --- /dev/null +++ b/vendor/github.com/klauspost/compress/huff0/huff0.go @@ -0,0 +1,337 @@ +// Package huff0 provides fast huffman encoding as used in zstd. +// +// See README.md at https://github.com/klauspost/compress/tree/master/huff0 for details. +package huff0 + +import ( + "errors" + "fmt" + "math" + "math/bits" + "sync" + + "github.com/klauspost/compress/fse" +) + +const ( + maxSymbolValue = 255 + + // zstandard limits tablelog to 11, see: + // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#huffman-tree-description + tableLogMax = 11 + tableLogDefault = 11 + minTablelog = 5 + huffNodesLen = 512 + + // BlockSizeMax is maximum input size for a single block uncompressed. + BlockSizeMax = 1<<18 - 1 +) + +var ( + // ErrIncompressible is returned when input is judged to be too hard to compress. + ErrIncompressible = errors.New("input is not compressible") + + // ErrUseRLE is returned from the compressor when the input is a single byte value repeated. + ErrUseRLE = errors.New("input is single value repeated") + + // ErrTooBig is return if input is too large for a single block. + ErrTooBig = errors.New("input too big") + + // ErrMaxDecodedSizeExceeded is return if input is too large for a single block. + ErrMaxDecodedSizeExceeded = errors.New("maximum output size exceeded") +) + +type ReusePolicy uint8 + +const ( + // ReusePolicyAllow will allow reuse if it produces smaller output. + ReusePolicyAllow ReusePolicy = iota + + // ReusePolicyPrefer will re-use aggressively if possible. + // This will not check if a new table will produce smaller output, + // except if the current table is impossible to use or + // compressed output is bigger than input. + ReusePolicyPrefer + + // ReusePolicyNone will disable re-use of tables. + // This is slightly faster than ReusePolicyAllow but may produce larger output. + ReusePolicyNone + + // ReusePolicyMust must allow reuse and produce smaller output. + ReusePolicyMust +) + +type Scratch struct { + count [maxSymbolValue + 1]uint32 + + // Per block parameters. + // These can be used to override compression parameters of the block. + // Do not touch, unless you know what you are doing. + + // Out is output buffer. + // If the scratch is re-used before the caller is done processing the output, + // set this field to nil. + // Otherwise the output buffer will be re-used for next Compression/Decompression step + // and allocation will be avoided. + Out []byte + + // OutTable will contain the table data only, if a new table has been generated. + // Slice of the returned data. + OutTable []byte + + // OutData will contain the compressed data. + // Slice of the returned data. + OutData []byte + + // MaxDecodedSize will set the maximum allowed output size. + // This value will automatically be set to BlockSizeMax if not set. + // Decoders will return ErrMaxDecodedSizeExceeded is this limit is exceeded. + MaxDecodedSize int + + br byteReader + + // MaxSymbolValue will override the maximum symbol value of the next block. + MaxSymbolValue uint8 + + // TableLog will attempt to override the tablelog for the next block. + // Must be <= 11 and >= 5. + TableLog uint8 + + // Reuse will specify the reuse policy + Reuse ReusePolicy + + // WantLogLess allows to specify a log 2 reduction that should at least be achieved, + // otherwise the block will be returned as incompressible. + // The reduction should then at least be (input size >> WantLogLess) + // If WantLogLess == 0 any improvement will do. + WantLogLess uint8 + + symbolLen uint16 // Length of active part of the symbol table. + maxCount int // count of the most probable symbol + clearCount bool // clear count + actualTableLog uint8 // Selected tablelog. + prevTableLog uint8 // Tablelog for previous table + prevTable cTable // Table used for previous compression. + cTable cTable // compression table + dt dTable // decompression table + nodes []nodeElt + tmpOut [4][]byte + fse *fse.Scratch + decPool sync.Pool // *[4][256]byte buffers. + huffWeight [maxSymbolValue + 1]byte +} + +// TransferCTable will transfer the previously used compression table. +func (s *Scratch) TransferCTable(src *Scratch) { + if cap(s.prevTable) < len(src.prevTable) { + s.prevTable = make(cTable, 0, maxSymbolValue+1) + } + s.prevTable = s.prevTable[:len(src.prevTable)] + copy(s.prevTable, src.prevTable) + s.prevTableLog = src.prevTableLog +} + +func (s *Scratch) prepare(in []byte) (*Scratch, error) { + if len(in) > BlockSizeMax { + return nil, ErrTooBig + } + if s == nil { + s = &Scratch{} + } + if s.MaxSymbolValue == 0 { + s.MaxSymbolValue = maxSymbolValue + } + if s.TableLog == 0 { + s.TableLog = tableLogDefault + } + if s.TableLog > tableLogMax || s.TableLog < minTablelog { + return nil, fmt.Errorf(" invalid tableLog %d (%d -> %d)", s.TableLog, minTablelog, tableLogMax) + } + if s.MaxDecodedSize <= 0 || s.MaxDecodedSize > BlockSizeMax { + s.MaxDecodedSize = BlockSizeMax + } + if s.clearCount && s.maxCount == 0 { + for i := range s.count { + s.count[i] = 0 + } + s.clearCount = false + } + if cap(s.Out) == 0 { + s.Out = make([]byte, 0, len(in)) + } + s.Out = s.Out[:0] + + s.OutTable = nil + s.OutData = nil + if cap(s.nodes) < huffNodesLen+1 { + s.nodes = make([]nodeElt, 0, huffNodesLen+1) + } + s.nodes = s.nodes[:0] + if s.fse == nil { + s.fse = &fse.Scratch{} + } + s.br.init(in) + + return s, nil +} + +type cTable []cTableEntry + +func (c cTable) write(s *Scratch) error { + var ( + // precomputed conversion table + bitsToWeight [tableLogMax + 1]byte + huffLog = s.actualTableLog + // last weight is not saved. + maxSymbolValue = uint8(s.symbolLen - 1) + huffWeight = s.huffWeight[:256] + ) + const ( + maxFSETableLog = 6 + ) + // convert to weight + bitsToWeight[0] = 0 + for n := uint8(1); n < huffLog+1; n++ { + bitsToWeight[n] = huffLog + 1 - n + } + + // Acquire histogram for FSE. + hist := s.fse.Histogram() + hist = hist[:256] + for i := range hist[:16] { + hist[i] = 0 + } + for n := uint8(0); n < maxSymbolValue; n++ { + v := bitsToWeight[c[n].nBits] & 15 + huffWeight[n] = v + hist[v]++ + } + + // FSE compress if feasible. + if maxSymbolValue >= 2 { + huffMaxCnt := uint32(0) + huffMax := uint8(0) + for i, v := range hist[:16] { + if v == 0 { + continue + } + huffMax = byte(i) + if v > huffMaxCnt { + huffMaxCnt = v + } + } + s.fse.HistogramFinished(huffMax, int(huffMaxCnt)) + s.fse.TableLog = maxFSETableLog + b, err := fse.Compress(huffWeight[:maxSymbolValue], s.fse) + if err == nil && len(b) < int(s.symbolLen>>1) { + s.Out = append(s.Out, uint8(len(b))) + s.Out = append(s.Out, b...) + return nil + } + // Unable to compress (RLE/uncompressible) + } + // write raw values as 4-bits (max : 15) + if maxSymbolValue > (256 - 128) { + // should not happen : likely means source cannot be compressed + return ErrIncompressible + } + op := s.Out + // special case, pack weights 4 bits/weight. + op = append(op, 128|(maxSymbolValue-1)) + // be sure it doesn't cause msan issue in final combination + huffWeight[maxSymbolValue] = 0 + for n := uint16(0); n < uint16(maxSymbolValue); n += 2 { + op = append(op, (huffWeight[n]<<4)|huffWeight[n+1]) + } + s.Out = op + return nil +} + +func (c cTable) estTableSize(s *Scratch) (sz int, err error) { + var ( + // precomputed conversion table + bitsToWeight [tableLogMax + 1]byte + huffLog = s.actualTableLog + // last weight is not saved. + maxSymbolValue = uint8(s.symbolLen - 1) + huffWeight = s.huffWeight[:256] + ) + const ( + maxFSETableLog = 6 + ) + // convert to weight + bitsToWeight[0] = 0 + for n := uint8(1); n < huffLog+1; n++ { + bitsToWeight[n] = huffLog + 1 - n + } + + // Acquire histogram for FSE. + hist := s.fse.Histogram() + hist = hist[:256] + for i := range hist[:16] { + hist[i] = 0 + } + for n := uint8(0); n < maxSymbolValue; n++ { + v := bitsToWeight[c[n].nBits] & 15 + huffWeight[n] = v + hist[v]++ + } + + // FSE compress if feasible. + if maxSymbolValue >= 2 { + huffMaxCnt := uint32(0) + huffMax := uint8(0) + for i, v := range hist[:16] { + if v == 0 { + continue + } + huffMax = byte(i) + if v > huffMaxCnt { + huffMaxCnt = v + } + } + s.fse.HistogramFinished(huffMax, int(huffMaxCnt)) + s.fse.TableLog = maxFSETableLog + b, err := fse.Compress(huffWeight[:maxSymbolValue], s.fse) + if err == nil && len(b) < int(s.symbolLen>>1) { + sz += 1 + len(b) + return sz, nil + } + // Unable to compress (RLE/uncompressible) + } + // write raw values as 4-bits (max : 15) + if maxSymbolValue > (256 - 128) { + // should not happen : likely means source cannot be compressed + return 0, ErrIncompressible + } + // special case, pack weights 4 bits/weight. + sz += 1 + int(maxSymbolValue/2) + return sz, nil +} + +// estimateSize returns the estimated size in bytes of the input represented in the +// histogram supplied. +func (c cTable) estimateSize(hist []uint32) int { + nbBits := uint32(7) + for i, v := range c[:len(hist)] { + nbBits += uint32(v.nBits) * hist[i] + } + return int(nbBits >> 3) +} + +// minSize returns the minimum possible size considering the shannon limit. +func (s *Scratch) minSize(total int) int { + nbBits := float64(7) + fTotal := float64(total) + for _, v := range s.count[:s.symbolLen] { + n := float64(v) + if n > 0 { + nbBits += math.Log2(fTotal/n) * n + } + } + return int(nbBits) >> 3 +} + +func highBit32(val uint32) (n uint32) { + return uint32(bits.Len32(val) - 1) +} diff --git a/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo.go b/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo.go new file mode 100644 index 000000000..3954c5121 --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo.go @@ -0,0 +1,34 @@ +// Package cpuinfo gives runtime info about the current CPU. +// +// This is a very limited module meant for use internally +// in this project. For more versatile solution check +// https://github.com/klauspost/cpuid. +package cpuinfo + +// HasBMI1 checks whether an x86 CPU supports the BMI1 extension. +func HasBMI1() bool { + return hasBMI1 +} + +// HasBMI2 checks whether an x86 CPU supports the BMI2 extension. +func HasBMI2() bool { + return hasBMI2 +} + +// DisableBMI2 will disable BMI2, for testing purposes. +// Call returned function to restore previous state. +func DisableBMI2() func() { + old := hasBMI2 + hasBMI2 = false + return func() { + hasBMI2 = old + } +} + +// HasBMI checks whether an x86 CPU supports both BMI1 and BMI2 extensions. +func HasBMI() bool { + return HasBMI1() && HasBMI2() +} + +var hasBMI1 bool +var hasBMI2 bool diff --git a/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo_amd64.go b/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo_amd64.go new file mode 100644 index 000000000..e802579c4 --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo_amd64.go @@ -0,0 +1,11 @@ +//go:build amd64 && !appengine && !noasm && gc +// +build amd64,!appengine,!noasm,gc + +package cpuinfo + +// go:noescape +func x86extensions() (bmi1, bmi2 bool) + +func init() { + hasBMI1, hasBMI2 = x86extensions() +} diff --git a/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo_amd64.s b/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo_amd64.s new file mode 100644 index 000000000..4465fbe9e --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/cpuinfo/cpuinfo_amd64.s @@ -0,0 +1,36 @@ +// +build !appengine +// +build gc +// +build !noasm + +#include "textflag.h" +#include "funcdata.h" +#include "go_asm.h" + +TEXT ·x86extensions(SB), NOSPLIT, $0 + // 1. determine max EAX value + XORQ AX, AX + CPUID + + CMPQ AX, $7 + JB unsupported + + // 2. EAX = 7, ECX = 0 --- see Table 3-8 "Information Returned by CPUID Instruction" + MOVQ $7, AX + MOVQ $0, CX + CPUID + + BTQ $3, BX // bit 3 = BMI1 + SETCS AL + + BTQ $8, BX // bit 8 = BMI2 + SETCS AH + + MOVB AL, bmi1+0(FP) + MOVB AH, bmi2+1(FP) + RET + +unsupported: + XORQ AX, AX + MOVB AL, bmi1+0(FP) + MOVB AL, bmi2+1(FP) + RET diff --git a/vendor/github.com/klauspost/compress/internal/snapref/LICENSE b/vendor/github.com/klauspost/compress/internal/snapref/LICENSE new file mode 100644 index 000000000..6050c10f4 --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/snapref/LICENSE @@ -0,0 +1,27 @@ +Copyright (c) 2011 The Snappy-Go Authors. All rights reserved. + +Redistribution and use in source and binary forms, with or without +modification, are permitted provided that the following conditions are +met: + + * Redistributions of source code must retain the above copyright +notice, this list of conditions and the following disclaimer. + * Redistributions in binary form must reproduce the above +copyright notice, this list of conditions and the following disclaimer +in the documentation and/or other materials provided with the +distribution. + * Neither the name of Google Inc. nor the names of its +contributors may be used to endorse or promote products derived from +this software without specific prior written permission. + +THIS SOFTWARE IS PROVIDED BY THE COPYRIGHT HOLDERS AND CONTRIBUTORS +"AS IS" AND ANY EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT +LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR +A PARTICULAR PURPOSE ARE DISCLAIMED. IN NO EVENT SHALL THE COPYRIGHT +OWNER OR CONTRIBUTORS BE LIABLE FOR ANY DIRECT, INDIRECT, INCIDENTAL, +SPECIAL, EXEMPLARY, OR CONSEQUENTIAL DAMAGES (INCLUDING, BUT NOT +LIMITED TO, PROCUREMENT OF SUBSTITUTE GOODS OR SERVICES; LOSS OF USE, +DATA, OR PROFITS; OR BUSINESS INTERRUPTION) HOWEVER CAUSED AND ON ANY +THEORY OF LIABILITY, WHETHER IN CONTRACT, STRICT LIABILITY, OR TORT +(INCLUDING NEGLIGENCE OR OTHERWISE) ARISING IN ANY WAY OUT OF THE USE +OF THIS SOFTWARE, EVEN IF ADVISED OF THE POSSIBILITY OF SUCH DAMAGE. diff --git a/vendor/github.com/klauspost/compress/internal/snapref/decode.go b/vendor/github.com/klauspost/compress/internal/snapref/decode.go new file mode 100644 index 000000000..40796a49d --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/snapref/decode.go @@ -0,0 +1,264 @@ +// Copyright 2011 The Snappy-Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package snapref + +import ( + "encoding/binary" + "errors" + "io" +) + +var ( + // ErrCorrupt reports that the input is invalid. + ErrCorrupt = errors.New("snappy: corrupt input") + // ErrTooLarge reports that the uncompressed length is too large. + ErrTooLarge = errors.New("snappy: decoded block is too large") + // ErrUnsupported reports that the input isn't supported. + ErrUnsupported = errors.New("snappy: unsupported input") + + errUnsupportedLiteralLength = errors.New("snappy: unsupported literal length") +) + +// DecodedLen returns the length of the decoded block. +func DecodedLen(src []byte) (int, error) { + v, _, err := decodedLen(src) + return v, err +} + +// decodedLen returns the length of the decoded block and the number of bytes +// that the length header occupied. +func decodedLen(src []byte) (blockLen, headerLen int, err error) { + v, n := binary.Uvarint(src) + if n <= 0 || v > 0xffffffff { + return 0, 0, ErrCorrupt + } + + const wordSize = 32 << (^uint(0) >> 32 & 1) + if wordSize == 32 && v > 0x7fffffff { + return 0, 0, ErrTooLarge + } + return int(v), n, nil +} + +const ( + decodeErrCodeCorrupt = 1 + decodeErrCodeUnsupportedLiteralLength = 2 +) + +// Decode returns the decoded form of src. The returned slice may be a sub- +// slice of dst if dst was large enough to hold the entire decoded block. +// Otherwise, a newly allocated slice will be returned. +// +// The dst and src must not overlap. It is valid to pass a nil dst. +// +// Decode handles the Snappy block format, not the Snappy stream format. +func Decode(dst, src []byte) ([]byte, error) { + dLen, s, err := decodedLen(src) + if err != nil { + return nil, err + } + if dLen <= len(dst) { + dst = dst[:dLen] + } else { + dst = make([]byte, dLen) + } + switch decode(dst, src[s:]) { + case 0: + return dst, nil + case decodeErrCodeUnsupportedLiteralLength: + return nil, errUnsupportedLiteralLength + } + return nil, ErrCorrupt +} + +// NewReader returns a new Reader that decompresses from r, using the framing +// format described at +// https://github.com/google/snappy/blob/master/framing_format.txt +func NewReader(r io.Reader) *Reader { + return &Reader{ + r: r, + decoded: make([]byte, maxBlockSize), + buf: make([]byte, maxEncodedLenOfMaxBlockSize+checksumSize), + } +} + +// Reader is an io.Reader that can read Snappy-compressed bytes. +// +// Reader handles the Snappy stream format, not the Snappy block format. +type Reader struct { + r io.Reader + err error + decoded []byte + buf []byte + // decoded[i:j] contains decoded bytes that have not yet been passed on. + i, j int + readHeader bool +} + +// Reset discards any buffered data, resets all state, and switches the Snappy +// reader to read from r. This permits reusing a Reader rather than allocating +// a new one. +func (r *Reader) Reset(reader io.Reader) { + r.r = reader + r.err = nil + r.i = 0 + r.j = 0 + r.readHeader = false +} + +func (r *Reader) readFull(p []byte, allowEOF bool) (ok bool) { + if _, r.err = io.ReadFull(r.r, p); r.err != nil { + if r.err == io.ErrUnexpectedEOF || (r.err == io.EOF && !allowEOF) { + r.err = ErrCorrupt + } + return false + } + return true +} + +func (r *Reader) fill() error { + for r.i >= r.j { + if !r.readFull(r.buf[:4], true) { + return r.err + } + chunkType := r.buf[0] + if !r.readHeader { + if chunkType != chunkTypeStreamIdentifier { + r.err = ErrCorrupt + return r.err + } + r.readHeader = true + } + chunkLen := int(r.buf[1]) | int(r.buf[2])<<8 | int(r.buf[3])<<16 + if chunkLen > len(r.buf) { + r.err = ErrUnsupported + return r.err + } + + // The chunk types are specified at + // https://github.com/google/snappy/blob/master/framing_format.txt + switch chunkType { + case chunkTypeCompressedData: + // Section 4.2. Compressed data (chunk type 0x00). + if chunkLen < checksumSize { + r.err = ErrCorrupt + return r.err + } + buf := r.buf[:chunkLen] + if !r.readFull(buf, false) { + return r.err + } + checksum := uint32(buf[0]) | uint32(buf[1])<<8 | uint32(buf[2])<<16 | uint32(buf[3])<<24 + buf = buf[checksumSize:] + + n, err := DecodedLen(buf) + if err != nil { + r.err = err + return r.err + } + if n > len(r.decoded) { + r.err = ErrCorrupt + return r.err + } + if _, err := Decode(r.decoded, buf); err != nil { + r.err = err + return r.err + } + if crc(r.decoded[:n]) != checksum { + r.err = ErrCorrupt + return r.err + } + r.i, r.j = 0, n + continue + + case chunkTypeUncompressedData: + // Section 4.3. Uncompressed data (chunk type 0x01). + if chunkLen < checksumSize { + r.err = ErrCorrupt + return r.err + } + buf := r.buf[:checksumSize] + if !r.readFull(buf, false) { + return r.err + } + checksum := uint32(buf[0]) | uint32(buf[1])<<8 | uint32(buf[2])<<16 | uint32(buf[3])<<24 + // Read directly into r.decoded instead of via r.buf. + n := chunkLen - checksumSize + if n > len(r.decoded) { + r.err = ErrCorrupt + return r.err + } + if !r.readFull(r.decoded[:n], false) { + return r.err + } + if crc(r.decoded[:n]) != checksum { + r.err = ErrCorrupt + return r.err + } + r.i, r.j = 0, n + continue + + case chunkTypeStreamIdentifier: + // Section 4.1. Stream identifier (chunk type 0xff). + if chunkLen != len(magicBody) { + r.err = ErrCorrupt + return r.err + } + if !r.readFull(r.buf[:len(magicBody)], false) { + return r.err + } + for i := 0; i < len(magicBody); i++ { + if r.buf[i] != magicBody[i] { + r.err = ErrCorrupt + return r.err + } + } + continue + } + + if chunkType <= 0x7f { + // Section 4.5. Reserved unskippable chunks (chunk types 0x02-0x7f). + r.err = ErrUnsupported + return r.err + } + // Section 4.4 Padding (chunk type 0xfe). + // Section 4.6. Reserved skippable chunks (chunk types 0x80-0xfd). + if !r.readFull(r.buf[:chunkLen], false) { + return r.err + } + } + + return nil +} + +// Read satisfies the io.Reader interface. +func (r *Reader) Read(p []byte) (int, error) { + if r.err != nil { + return 0, r.err + } + + if err := r.fill(); err != nil { + return 0, err + } + + n := copy(p, r.decoded[r.i:r.j]) + r.i += n + return n, nil +} + +// ReadByte satisfies the io.ByteReader interface. +func (r *Reader) ReadByte() (byte, error) { + if r.err != nil { + return 0, r.err + } + + if err := r.fill(); err != nil { + return 0, err + } + + c := r.decoded[r.i] + r.i++ + return c, nil +} diff --git a/vendor/github.com/klauspost/compress/internal/snapref/decode_other.go b/vendor/github.com/klauspost/compress/internal/snapref/decode_other.go new file mode 100644 index 000000000..77395a6b8 --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/snapref/decode_other.go @@ -0,0 +1,113 @@ +// Copyright 2016 The Snappy-Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package snapref + +// decode writes the decoding of src to dst. It assumes that the varint-encoded +// length of the decompressed bytes has already been read, and that len(dst) +// equals that length. +// +// It returns 0 on success or a decodeErrCodeXxx error code on failure. +func decode(dst, src []byte) int { + var d, s, offset, length int + for s < len(src) { + switch src[s] & 0x03 { + case tagLiteral: + x := uint32(src[s] >> 2) + switch { + case x < 60: + s++ + case x == 60: + s += 2 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + return decodeErrCodeCorrupt + } + x = uint32(src[s-1]) + case x == 61: + s += 3 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + return decodeErrCodeCorrupt + } + x = uint32(src[s-2]) | uint32(src[s-1])<<8 + case x == 62: + s += 4 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + return decodeErrCodeCorrupt + } + x = uint32(src[s-3]) | uint32(src[s-2])<<8 | uint32(src[s-1])<<16 + case x == 63: + s += 5 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + return decodeErrCodeCorrupt + } + x = uint32(src[s-4]) | uint32(src[s-3])<<8 | uint32(src[s-2])<<16 | uint32(src[s-1])<<24 + } + length = int(x) + 1 + if length <= 0 { + return decodeErrCodeUnsupportedLiteralLength + } + if length > len(dst)-d || length > len(src)-s { + return decodeErrCodeCorrupt + } + copy(dst[d:], src[s:s+length]) + d += length + s += length + continue + + case tagCopy1: + s += 2 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + return decodeErrCodeCorrupt + } + length = 4 + int(src[s-2])>>2&0x7 + offset = int(uint32(src[s-2])&0xe0<<3 | uint32(src[s-1])) + + case tagCopy2: + s += 3 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + return decodeErrCodeCorrupt + } + length = 1 + int(src[s-3])>>2 + offset = int(uint32(src[s-2]) | uint32(src[s-1])<<8) + + case tagCopy4: + s += 5 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + return decodeErrCodeCorrupt + } + length = 1 + int(src[s-5])>>2 + offset = int(uint32(src[s-4]) | uint32(src[s-3])<<8 | uint32(src[s-2])<<16 | uint32(src[s-1])<<24) + } + + if offset <= 0 || d < offset || length > len(dst)-d { + return decodeErrCodeCorrupt + } + // Copy from an earlier sub-slice of dst to a later sub-slice. + // If no overlap, use the built-in copy: + if offset >= length { + copy(dst[d:d+length], dst[d-offset:]) + d += length + continue + } + + // Unlike the built-in copy function, this byte-by-byte copy always runs + // forwards, even if the slices overlap. Conceptually, this is: + // + // d += forwardCopy(dst[d:d+length], dst[d-offset:]) + // + // We align the slices into a and b and show the compiler they are the same size. + // This allows the loop to run without bounds checks. + a := dst[d : d+length] + b := dst[d-offset:] + b = b[:len(a)] + for i := range a { + a[i] = b[i] + } + d += length + } + if d != len(dst) { + return decodeErrCodeCorrupt + } + return 0 +} diff --git a/vendor/github.com/klauspost/compress/internal/snapref/encode.go b/vendor/github.com/klauspost/compress/internal/snapref/encode.go new file mode 100644 index 000000000..13c6040a5 --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/snapref/encode.go @@ -0,0 +1,289 @@ +// Copyright 2011 The Snappy-Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package snapref + +import ( + "encoding/binary" + "errors" + "io" +) + +// Encode returns the encoded form of src. The returned slice may be a sub- +// slice of dst if dst was large enough to hold the entire encoded block. +// Otherwise, a newly allocated slice will be returned. +// +// The dst and src must not overlap. It is valid to pass a nil dst. +// +// Encode handles the Snappy block format, not the Snappy stream format. +func Encode(dst, src []byte) []byte { + if n := MaxEncodedLen(len(src)); n < 0 { + panic(ErrTooLarge) + } else if len(dst) < n { + dst = make([]byte, n) + } + + // The block starts with the varint-encoded length of the decompressed bytes. + d := binary.PutUvarint(dst, uint64(len(src))) + + for len(src) > 0 { + p := src + src = nil + if len(p) > maxBlockSize { + p, src = p[:maxBlockSize], p[maxBlockSize:] + } + if len(p) < minNonLiteralBlockSize { + d += emitLiteral(dst[d:], p) + } else { + d += encodeBlock(dst[d:], p) + } + } + return dst[:d] +} + +// inputMargin is the minimum number of extra input bytes to keep, inside +// encodeBlock's inner loop. On some architectures, this margin lets us +// implement a fast path for emitLiteral, where the copy of short (<= 16 byte) +// literals can be implemented as a single load to and store from a 16-byte +// register. That literal's actual length can be as short as 1 byte, so this +// can copy up to 15 bytes too much, but that's OK as subsequent iterations of +// the encoding loop will fix up the copy overrun, and this inputMargin ensures +// that we don't overrun the dst and src buffers. +const inputMargin = 16 - 1 + +// minNonLiteralBlockSize is the minimum size of the input to encodeBlock that +// could be encoded with a copy tag. This is the minimum with respect to the +// algorithm used by encodeBlock, not a minimum enforced by the file format. +// +// The encoded output must start with at least a 1 byte literal, as there are +// no previous bytes to copy. A minimal (1 byte) copy after that, generated +// from an emitCopy call in encodeBlock's main loop, would require at least +// another inputMargin bytes, for the reason above: we want any emitLiteral +// calls inside encodeBlock's main loop to use the fast path if possible, which +// requires being able to overrun by inputMargin bytes. Thus, +// minNonLiteralBlockSize equals 1 + 1 + inputMargin. +// +// The C++ code doesn't use this exact threshold, but it could, as discussed at +// https://groups.google.com/d/topic/snappy-compression/oGbhsdIJSJ8/discussion +// The difference between Go (2+inputMargin) and C++ (inputMargin) is purely an +// optimization. It should not affect the encoded form. This is tested by +// TestSameEncodingAsCppShortCopies. +const minNonLiteralBlockSize = 1 + 1 + inputMargin + +// MaxEncodedLen returns the maximum length of a snappy block, given its +// uncompressed length. +// +// It will return a negative value if srcLen is too large to encode. +func MaxEncodedLen(srcLen int) int { + n := uint64(srcLen) + if n > 0xffffffff { + return -1 + } + // Compressed data can be defined as: + // compressed := item* literal* + // item := literal* copy + // + // The trailing literal sequence has a space blowup of at most 62/60 + // since a literal of length 60 needs one tag byte + one extra byte + // for length information. + // + // Item blowup is trickier to measure. Suppose the "copy" op copies + // 4 bytes of data. Because of a special check in the encoding code, + // we produce a 4-byte copy only if the offset is < 65536. Therefore + // the copy op takes 3 bytes to encode, and this type of item leads + // to at most the 62/60 blowup for representing literals. + // + // Suppose the "copy" op copies 5 bytes of data. If the offset is big + // enough, it will take 5 bytes to encode the copy op. Therefore the + // worst case here is a one-byte literal followed by a five-byte copy. + // That is, 6 bytes of input turn into 7 bytes of "compressed" data. + // + // This last factor dominates the blowup, so the final estimate is: + n = 32 + n + n/6 + if n > 0xffffffff { + return -1 + } + return int(n) +} + +var errClosed = errors.New("snappy: Writer is closed") + +// NewWriter returns a new Writer that compresses to w. +// +// The Writer returned does not buffer writes. There is no need to Flush or +// Close such a Writer. +// +// Deprecated: the Writer returned is not suitable for many small writes, only +// for few large writes. Use NewBufferedWriter instead, which is efficient +// regardless of the frequency and shape of the writes, and remember to Close +// that Writer when done. +func NewWriter(w io.Writer) *Writer { + return &Writer{ + w: w, + obuf: make([]byte, obufLen), + } +} + +// NewBufferedWriter returns a new Writer that compresses to w, using the +// framing format described at +// https://github.com/google/snappy/blob/master/framing_format.txt +// +// The Writer returned buffers writes. Users must call Close to guarantee all +// data has been forwarded to the underlying io.Writer. They may also call +// Flush zero or more times before calling Close. +func NewBufferedWriter(w io.Writer) *Writer { + return &Writer{ + w: w, + ibuf: make([]byte, 0, maxBlockSize), + obuf: make([]byte, obufLen), + } +} + +// Writer is an io.Writer that can write Snappy-compressed bytes. +// +// Writer handles the Snappy stream format, not the Snappy block format. +type Writer struct { + w io.Writer + err error + + // ibuf is a buffer for the incoming (uncompressed) bytes. + // + // Its use is optional. For backwards compatibility, Writers created by the + // NewWriter function have ibuf == nil, do not buffer incoming bytes, and + // therefore do not need to be Flush'ed or Close'd. + ibuf []byte + + // obuf is a buffer for the outgoing (compressed) bytes. + obuf []byte + + // wroteStreamHeader is whether we have written the stream header. + wroteStreamHeader bool +} + +// Reset discards the writer's state and switches the Snappy writer to write to +// w. This permits reusing a Writer rather than allocating a new one. +func (w *Writer) Reset(writer io.Writer) { + w.w = writer + w.err = nil + if w.ibuf != nil { + w.ibuf = w.ibuf[:0] + } + w.wroteStreamHeader = false +} + +// Write satisfies the io.Writer interface. +func (w *Writer) Write(p []byte) (nRet int, errRet error) { + if w.ibuf == nil { + // Do not buffer incoming bytes. This does not perform or compress well + // if the caller of Writer.Write writes many small slices. This + // behavior is therefore deprecated, but still supported for backwards + // compatibility with code that doesn't explicitly Flush or Close. + return w.write(p) + } + + // The remainder of this method is based on bufio.Writer.Write from the + // standard library. + + for len(p) > (cap(w.ibuf)-len(w.ibuf)) && w.err == nil { + var n int + if len(w.ibuf) == 0 { + // Large write, empty buffer. + // Write directly from p to avoid copy. + n, _ = w.write(p) + } else { + n = copy(w.ibuf[len(w.ibuf):cap(w.ibuf)], p) + w.ibuf = w.ibuf[:len(w.ibuf)+n] + w.Flush() + } + nRet += n + p = p[n:] + } + if w.err != nil { + return nRet, w.err + } + n := copy(w.ibuf[len(w.ibuf):cap(w.ibuf)], p) + w.ibuf = w.ibuf[:len(w.ibuf)+n] + nRet += n + return nRet, nil +} + +func (w *Writer) write(p []byte) (nRet int, errRet error) { + if w.err != nil { + return 0, w.err + } + for len(p) > 0 { + obufStart := len(magicChunk) + if !w.wroteStreamHeader { + w.wroteStreamHeader = true + copy(w.obuf, magicChunk) + obufStart = 0 + } + + var uncompressed []byte + if len(p) > maxBlockSize { + uncompressed, p = p[:maxBlockSize], p[maxBlockSize:] + } else { + uncompressed, p = p, nil + } + checksum := crc(uncompressed) + + // Compress the buffer, discarding the result if the improvement + // isn't at least 12.5%. + compressed := Encode(w.obuf[obufHeaderLen:], uncompressed) + chunkType := uint8(chunkTypeCompressedData) + chunkLen := 4 + len(compressed) + obufEnd := obufHeaderLen + len(compressed) + if len(compressed) >= len(uncompressed)-len(uncompressed)/8 { + chunkType = chunkTypeUncompressedData + chunkLen = 4 + len(uncompressed) + obufEnd = obufHeaderLen + } + + // Fill in the per-chunk header that comes before the body. + w.obuf[len(magicChunk)+0] = chunkType + w.obuf[len(magicChunk)+1] = uint8(chunkLen >> 0) + w.obuf[len(magicChunk)+2] = uint8(chunkLen >> 8) + w.obuf[len(magicChunk)+3] = uint8(chunkLen >> 16) + w.obuf[len(magicChunk)+4] = uint8(checksum >> 0) + w.obuf[len(magicChunk)+5] = uint8(checksum >> 8) + w.obuf[len(magicChunk)+6] = uint8(checksum >> 16) + w.obuf[len(magicChunk)+7] = uint8(checksum >> 24) + + if _, err := w.w.Write(w.obuf[obufStart:obufEnd]); err != nil { + w.err = err + return nRet, err + } + if chunkType == chunkTypeUncompressedData { + if _, err := w.w.Write(uncompressed); err != nil { + w.err = err + return nRet, err + } + } + nRet += len(uncompressed) + } + return nRet, nil +} + +// Flush flushes the Writer to its underlying io.Writer. +func (w *Writer) Flush() error { + if w.err != nil { + return w.err + } + if len(w.ibuf) == 0 { + return nil + } + w.write(w.ibuf) + w.ibuf = w.ibuf[:0] + return w.err +} + +// Close calls Flush and then closes the Writer. +func (w *Writer) Close() error { + w.Flush() + ret := w.err + if w.err == nil { + w.err = errClosed + } + return ret +} diff --git a/vendor/github.com/klauspost/compress/internal/snapref/encode_other.go b/vendor/github.com/klauspost/compress/internal/snapref/encode_other.go new file mode 100644 index 000000000..2aa6a95a0 --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/snapref/encode_other.go @@ -0,0 +1,250 @@ +// Copyright 2016 The Snappy-Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +package snapref + +func load32(b []byte, i int) uint32 { + b = b[i : i+4 : len(b)] // Help the compiler eliminate bounds checks on the next line. + return uint32(b[0]) | uint32(b[1])<<8 | uint32(b[2])<<16 | uint32(b[3])<<24 +} + +func load64(b []byte, i int) uint64 { + b = b[i : i+8 : len(b)] // Help the compiler eliminate bounds checks on the next line. + return uint64(b[0]) | uint64(b[1])<<8 | uint64(b[2])<<16 | uint64(b[3])<<24 | + uint64(b[4])<<32 | uint64(b[5])<<40 | uint64(b[6])<<48 | uint64(b[7])<<56 +} + +// emitLiteral writes a literal chunk and returns the number of bytes written. +// +// It assumes that: +// +// dst is long enough to hold the encoded bytes +// 1 <= len(lit) && len(lit) <= 65536 +func emitLiteral(dst, lit []byte) int { + i, n := 0, uint(len(lit)-1) + switch { + case n < 60: + dst[0] = uint8(n)<<2 | tagLiteral + i = 1 + case n < 1<<8: + dst[0] = 60<<2 | tagLiteral + dst[1] = uint8(n) + i = 2 + default: + dst[0] = 61<<2 | tagLiteral + dst[1] = uint8(n) + dst[2] = uint8(n >> 8) + i = 3 + } + return i + copy(dst[i:], lit) +} + +// emitCopy writes a copy chunk and returns the number of bytes written. +// +// It assumes that: +// +// dst is long enough to hold the encoded bytes +// 1 <= offset && offset <= 65535 +// 4 <= length && length <= 65535 +func emitCopy(dst []byte, offset, length int) int { + i := 0 + // The maximum length for a single tagCopy1 or tagCopy2 op is 64 bytes. The + // threshold for this loop is a little higher (at 68 = 64 + 4), and the + // length emitted down below is is a little lower (at 60 = 64 - 4), because + // it's shorter to encode a length 67 copy as a length 60 tagCopy2 followed + // by a length 7 tagCopy1 (which encodes as 3+2 bytes) than to encode it as + // a length 64 tagCopy2 followed by a length 3 tagCopy2 (which encodes as + // 3+3 bytes). The magic 4 in the 64±4 is because the minimum length for a + // tagCopy1 op is 4 bytes, which is why a length 3 copy has to be an + // encodes-as-3-bytes tagCopy2 instead of an encodes-as-2-bytes tagCopy1. + for length >= 68 { + // Emit a length 64 copy, encoded as 3 bytes. + dst[i+0] = 63<<2 | tagCopy2 + dst[i+1] = uint8(offset) + dst[i+2] = uint8(offset >> 8) + i += 3 + length -= 64 + } + if length > 64 { + // Emit a length 60 copy, encoded as 3 bytes. + dst[i+0] = 59<<2 | tagCopy2 + dst[i+1] = uint8(offset) + dst[i+2] = uint8(offset >> 8) + i += 3 + length -= 60 + } + if length >= 12 || offset >= 2048 { + // Emit the remaining copy, encoded as 3 bytes. + dst[i+0] = uint8(length-1)<<2 | tagCopy2 + dst[i+1] = uint8(offset) + dst[i+2] = uint8(offset >> 8) + return i + 3 + } + // Emit the remaining copy, encoded as 2 bytes. + dst[i+0] = uint8(offset>>8)<<5 | uint8(length-4)<<2 | tagCopy1 + dst[i+1] = uint8(offset) + return i + 2 +} + +func hash(u, shift uint32) uint32 { + return (u * 0x1e35a7bd) >> shift +} + +// EncodeBlockInto exposes encodeBlock but checks dst size. +func EncodeBlockInto(dst, src []byte) (d int) { + if MaxEncodedLen(len(src)) > len(dst) { + return 0 + } + + // encodeBlock breaks on too big blocks, so split. + for len(src) > 0 { + p := src + src = nil + if len(p) > maxBlockSize { + p, src = p[:maxBlockSize], p[maxBlockSize:] + } + if len(p) < minNonLiteralBlockSize { + d += emitLiteral(dst[d:], p) + } else { + d += encodeBlock(dst[d:], p) + } + } + return d +} + +// encodeBlock encodes a non-empty src to a guaranteed-large-enough dst. It +// assumes that the varint-encoded length of the decompressed bytes has already +// been written. +// +// It also assumes that: +// +// len(dst) >= MaxEncodedLen(len(src)) && +// minNonLiteralBlockSize <= len(src) && len(src) <= maxBlockSize +func encodeBlock(dst, src []byte) (d int) { + // Initialize the hash table. Its size ranges from 1<<8 to 1<<14 inclusive. + // The table element type is uint16, as s < sLimit and sLimit < len(src) + // and len(src) <= maxBlockSize and maxBlockSize == 65536. + const ( + maxTableSize = 1 << 14 + // tableMask is redundant, but helps the compiler eliminate bounds + // checks. + tableMask = maxTableSize - 1 + ) + shift := uint32(32 - 8) + for tableSize := 1 << 8; tableSize < maxTableSize && tableSize < len(src); tableSize *= 2 { + shift-- + } + // In Go, all array elements are zero-initialized, so there is no advantage + // to a smaller tableSize per se. However, it matches the C++ algorithm, + // and in the asm versions of this code, we can get away with zeroing only + // the first tableSize elements. + var table [maxTableSize]uint16 + + // sLimit is when to stop looking for offset/length copies. The inputMargin + // lets us use a fast path for emitLiteral in the main loop, while we are + // looking for copies. + sLimit := len(src) - inputMargin + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := 0 + + // The encoded form must start with a literal, as there are no previous + // bytes to copy, so we start looking for hash matches at s == 1. + s := 1 + nextHash := hash(load32(src, s), shift) + + for { + // Copied from the C++ snappy implementation: + // + // Heuristic match skipping: If 32 bytes are scanned with no matches + // found, start looking only at every other byte. If 32 more bytes are + // scanned (or skipped), look at every third byte, etc.. When a match + // is found, immediately go back to looking at every byte. This is a + // small loss (~5% performance, ~0.1% density) for compressible data + // due to more bookkeeping, but for non-compressible data (such as + // JPEG) it's a huge win since the compressor quickly "realizes" the + // data is incompressible and doesn't bother looking for matches + // everywhere. + // + // The "skip" variable keeps track of how many bytes there are since + // the last match; dividing it by 32 (ie. right-shifting by five) gives + // the number of bytes to move ahead for each iteration. + skip := 32 + + nextS := s + candidate := 0 + for { + s = nextS + bytesBetweenHashLookups := skip >> 5 + nextS = s + bytesBetweenHashLookups + skip += bytesBetweenHashLookups + if nextS > sLimit { + goto emitRemainder + } + candidate = int(table[nextHash&tableMask]) + table[nextHash&tableMask] = uint16(s) + nextHash = hash(load32(src, nextS), shift) + if load32(src, s) == load32(src, candidate) { + break + } + } + + // A 4-byte match has been found. We'll later see if more than 4 bytes + // match. But, prior to the match, src[nextEmit:s] are unmatched. Emit + // them as literal bytes. + d += emitLiteral(dst[d:], src[nextEmit:s]) + + // Call emitCopy, and then see if another emitCopy could be our next + // move. Repeat until we find no match for the input immediately after + // what was consumed by the last emitCopy call. + // + // If we exit this loop normally then we need to call emitLiteral next, + // though we don't yet know how big the literal will be. We handle that + // by proceeding to the next iteration of the main loop. We also can + // exit this loop via goto if we get close to exhausting the input. + for { + // Invariant: we have a 4-byte match at s, and no need to emit any + // literal bytes prior to s. + base := s + + // Extend the 4-byte match as long as possible. + // + // This is an inlined version of: + // s = extendMatch(src, candidate+4, s+4) + s += 4 + for i := candidate + 4; s < len(src) && src[i] == src[s]; i, s = i+1, s+1 { + } + + d += emitCopy(dst[d:], base-candidate, s-base) + nextEmit = s + if s >= sLimit { + goto emitRemainder + } + + // We could immediately start working at s now, but to improve + // compression we first update the hash table at s-1 and at s. If + // another emitCopy is not our next move, also calculate nextHash + // at s+1. At least on GOARCH=amd64, these three hash calculations + // are faster as one load64 call (with some shifts) instead of + // three load32 calls. + x := load64(src, s-1) + prevHash := hash(uint32(x>>0), shift) + table[prevHash&tableMask] = uint16(s - 1) + currHash := hash(uint32(x>>8), shift) + candidate = int(table[currHash&tableMask]) + table[currHash&tableMask] = uint16(s) + if uint32(x>>8) != load32(src, candidate) { + nextHash = hash(uint32(x>>16), shift) + s++ + break + } + } + } + +emitRemainder: + if nextEmit < len(src) { + d += emitLiteral(dst[d:], src[nextEmit:]) + } + return d +} diff --git a/vendor/github.com/klauspost/compress/internal/snapref/snappy.go b/vendor/github.com/klauspost/compress/internal/snapref/snappy.go new file mode 100644 index 000000000..34d01f4aa --- /dev/null +++ b/vendor/github.com/klauspost/compress/internal/snapref/snappy.go @@ -0,0 +1,98 @@ +// Copyright 2011 The Snappy-Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. + +// Package snapref implements the Snappy compression format. It aims for very +// high speeds and reasonable compression. +// +// There are actually two Snappy formats: block and stream. They are related, +// but different: trying to decompress block-compressed data as a Snappy stream +// will fail, and vice versa. The block format is the Decode and Encode +// functions and the stream format is the Reader and Writer types. +// +// The block format, the more common case, is used when the complete size (the +// number of bytes) of the original data is known upfront, at the time +// compression starts. The stream format, also known as the framing format, is +// for when that isn't always true. +// +// The canonical, C++ implementation is at https://github.com/google/snappy and +// it only implements the block format. +package snapref + +import ( + "hash/crc32" +) + +/* +Each encoded block begins with the varint-encoded length of the decoded data, +followed by a sequence of chunks. Chunks begin and end on byte boundaries. The +first byte of each chunk is broken into its 2 least and 6 most significant bits +called l and m: l ranges in [0, 4) and m ranges in [0, 64). l is the chunk tag. +Zero means a literal tag. All other values mean a copy tag. + +For literal tags: + - If m < 60, the next 1 + m bytes are literal bytes. + - Otherwise, let n be the little-endian unsigned integer denoted by the next + m - 59 bytes. The next 1 + n bytes after that are literal bytes. + +For copy tags, length bytes are copied from offset bytes ago, in the style of +Lempel-Ziv compression algorithms. In particular: + - For l == 1, the offset ranges in [0, 1<<11) and the length in [4, 12). + The length is 4 + the low 3 bits of m. The high 3 bits of m form bits 8-10 + of the offset. The next byte is bits 0-7 of the offset. + - For l == 2, the offset ranges in [0, 1<<16) and the length in [1, 65). + The length is 1 + m. The offset is the little-endian unsigned integer + denoted by the next 2 bytes. + - For l == 3, this tag is a legacy format that is no longer issued by most + encoders. Nonetheless, the offset ranges in [0, 1<<32) and the length in + [1, 65). The length is 1 + m. The offset is the little-endian unsigned + integer denoted by the next 4 bytes. +*/ +const ( + tagLiteral = 0x00 + tagCopy1 = 0x01 + tagCopy2 = 0x02 + tagCopy4 = 0x03 +) + +const ( + checksumSize = 4 + chunkHeaderSize = 4 + magicChunk = "\xff\x06\x00\x00" + magicBody + magicBody = "sNaPpY" + + // maxBlockSize is the maximum size of the input to encodeBlock. It is not + // part of the wire format per se, but some parts of the encoder assume + // that an offset fits into a uint16. + // + // Also, for the framing format (Writer type instead of Encode function), + // https://github.com/google/snappy/blob/master/framing_format.txt says + // that "the uncompressed data in a chunk must be no longer than 65536 + // bytes". + maxBlockSize = 65536 + + // maxEncodedLenOfMaxBlockSize equals MaxEncodedLen(maxBlockSize), but is + // hard coded to be a const instead of a variable, so that obufLen can also + // be a const. Their equivalence is confirmed by + // TestMaxEncodedLenOfMaxBlockSize. + maxEncodedLenOfMaxBlockSize = 76490 + + obufHeaderLen = len(magicChunk) + checksumSize + chunkHeaderSize + obufLen = obufHeaderLen + maxEncodedLenOfMaxBlockSize +) + +const ( + chunkTypeCompressedData = 0x00 + chunkTypeUncompressedData = 0x01 + chunkTypePadding = 0xfe + chunkTypeStreamIdentifier = 0xff +) + +var crcTable = crc32.MakeTable(crc32.Castagnoli) + +// crc implements the checksum specified in section 3 of +// https://github.com/google/snappy/blob/master/framing_format.txt +func crc(b []byte) uint32 { + c := crc32.Update(0, crcTable, b) + return uint32(c>>15|c<<17) + 0xa282ead8 +} diff --git a/vendor/github.com/klauspost/compress/s2sx.mod b/vendor/github.com/klauspost/compress/s2sx.mod new file mode 100644 index 000000000..2263853fc --- /dev/null +++ b/vendor/github.com/klauspost/compress/s2sx.mod @@ -0,0 +1,4 @@ +module github.com/klauspost/compress + +go 1.16 + diff --git a/vendor/github.com/klauspost/compress/s2sx.sum b/vendor/github.com/klauspost/compress/s2sx.sum new file mode 100644 index 000000000..e69de29bb diff --git a/vendor/github.com/klauspost/compress/zstd/README.md b/vendor/github.com/klauspost/compress/zstd/README.md new file mode 100644 index 000000000..bdd49c8b2 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/README.md @@ -0,0 +1,441 @@ +# zstd + +[Zstandard](https://facebook.github.io/zstd/) is a real-time compression algorithm, providing high compression ratios. +It offers a very wide range of compression / speed trade-off, while being backed by a very fast decoder. +A high performance compression algorithm is implemented. For now focused on speed. + +This package provides [compression](#Compressor) to and [decompression](#Decompressor) of Zstandard content. + +This package is pure Go and without use of "unsafe". + +The `zstd` package is provided as open source software using a Go standard license. + +Currently the package is heavily optimized for 64 bit processors and will be significantly slower on 32 bit processors. + +For seekable zstd streams, see [this excellent package](https://github.com/SaveTheRbtz/zstd-seekable-format-go). + +## Installation + +Install using `go get -u github.com/klauspost/compress`. The package is located in `github.com/klauspost/compress/zstd`. + +[![Go Reference](https://pkg.go.dev/badge/github.com/klauspost/compress/zstd.svg)](https://pkg.go.dev/github.com/klauspost/compress/zstd) + +## Compressor + +### Status: + +STABLE - there may always be subtle bugs, a wide variety of content has been tested and the library is actively +used by several projects. This library is being [fuzz-tested](https://github.com/klauspost/compress-fuzz) for all updates. + +There may still be specific combinations of data types/size/settings that could lead to edge cases, +so as always, testing is recommended. + +For now, a high speed (fastest) and medium-fast (default) compressor has been implemented. + +* The "Fastest" compression ratio is roughly equivalent to zstd level 1. +* The "Default" compression ratio is roughly equivalent to zstd level 3 (default). +* The "Better" compression ratio is roughly equivalent to zstd level 7. +* The "Best" compression ratio is roughly equivalent to zstd level 11. + +In terms of speed, it is typically 2x as fast as the stdlib deflate/gzip in its fastest mode. +The compression ratio compared to stdlib is around level 3, but usually 3x as fast. + + +### Usage + +An Encoder can be used for either compressing a stream via the +`io.WriteCloser` interface supported by the Encoder or as multiple independent +tasks via the `EncodeAll` function. +Smaller encodes are encouraged to use the EncodeAll function. +Use `NewWriter` to create a new instance that can be used for both. + +To create a writer with default options, do like this: + +```Go +// Compress input to output. +func Compress(in io.Reader, out io.Writer) error { + enc, err := zstd.NewWriter(out) + if err != nil { + return err + } + _, err = io.Copy(enc, in) + if err != nil { + enc.Close() + return err + } + return enc.Close() +} +``` + +Now you can encode by writing data to `enc`. The output will be finished writing when `Close()` is called. +Even if your encode fails, you should still call `Close()` to release any resources that may be held up. + +The above is fine for big encodes. However, whenever possible try to *reuse* the writer. + +To reuse the encoder, you can use the `Reset(io.Writer)` function to change to another output. +This will allow the encoder to reuse all resources and avoid wasteful allocations. + +Currently stream encoding has 'light' concurrency, meaning up to 2 goroutines can be working on part +of a stream. This is independent of the `WithEncoderConcurrency(n)`, but that is likely to change +in the future. So if you want to limit concurrency for future updates, specify the concurrency +you would like. + +If you would like stream encoding to be done without spawning async goroutines, use `WithEncoderConcurrency(1)` +which will compress input as each block is completed, blocking on writes until each has completed. + +You can specify your desired compression level using `WithEncoderLevel()` option. Currently only pre-defined +compression settings can be specified. + +#### Future Compatibility Guarantees + +This will be an evolving project. When using this package it is important to note that both the compression efficiency and speed may change. + +The goal will be to keep the default efficiency at the default zstd (level 3). +However the encoding should never be assumed to remain the same, +and you should not use hashes of compressed output for similarity checks. + +The Encoder can be assumed to produce the same output from the exact same code version. +However, the may be modes in the future that break this, +although they will not be enabled without an explicit option. + +This encoder is not designed to (and will probably never) output the exact same bitstream as the reference encoder. + +Also note, that the cgo decompressor currently does not [report all errors on invalid input](https://github.com/DataDog/zstd/issues/59), +[omits error checks](https://github.com/DataDog/zstd/issues/61), [ignores checksums](https://github.com/DataDog/zstd/issues/43) +and seems to ignore concatenated streams, even though [it is part of the spec](https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#frames). + +#### Blocks + +For compressing small blocks, the returned encoder has a function called `EncodeAll(src, dst []byte) []byte`. + +`EncodeAll` will encode all input in src and append it to dst. +This function can be called concurrently. +Each call will only run on a same goroutine as the caller. + +Encoded blocks can be concatenated and the result will be the combined input stream. +Data compressed with EncodeAll can be decoded with the Decoder, using either a stream or `DecodeAll`. + +Especially when encoding blocks you should take special care to reuse the encoder. +This will effectively make it run without allocations after a warmup period. +To make it run completely without allocations, supply a destination buffer with space for all content. + +```Go +import "github.com/klauspost/compress/zstd" + +// Create a writer that caches compressors. +// For this operation type we supply a nil Reader. +var encoder, _ = zstd.NewWriter(nil) + +// Compress a buffer. +// If you have a destination buffer, the allocation in the call can also be eliminated. +func Compress(src []byte) []byte { + return encoder.EncodeAll(src, make([]byte, 0, len(src))) +} +``` + +You can control the maximum number of concurrent encodes using the `WithEncoderConcurrency(n)` +option when creating the writer. + +Using the Encoder for both a stream and individual blocks concurrently is safe. + +### Performance + +I have collected some speed examples to compare speed and compression against other compressors. + +* `file` is the input file. +* `out` is the compressor used. `zskp` is this package. `zstd` is the Datadog cgo library. `gzstd/gzkp` is gzip standard and this library. +* `level` is the compression level used. For `zskp` level 1 is "fastest", level 2 is "default"; 3 is "better", 4 is "best". +* `insize`/`outsize` is the input/output size. +* `millis` is the number of milliseconds used for compression. +* `mb/s` is megabytes (2^20 bytes) per second. + +``` +Silesia Corpus: +http://sun.aei.polsl.pl/~sdeor/corpus/silesia.zip + +This package: +file out level insize outsize millis mb/s +silesia.tar zskp 1 211947520 73821326 634 318.47 +silesia.tar zskp 2 211947520 67655404 1508 133.96 +silesia.tar zskp 3 211947520 64746933 3000 67.37 +silesia.tar zskp 4 211947520 60073508 16926 11.94 + +cgo zstd: +silesia.tar zstd 1 211947520 73605392 543 371.56 +silesia.tar zstd 3 211947520 66793289 864 233.68 +silesia.tar zstd 6 211947520 62916450 1913 105.66 +silesia.tar zstd 9 211947520 60212393 5063 39.92 + +gzip, stdlib/this package: +silesia.tar gzstd 1 211947520 80007735 1498 134.87 +silesia.tar gzkp 1 211947520 80088272 1009 200.31 + +GOB stream of binary data. Highly compressible. +https://files.klauspost.com/compress/gob-stream.7z + +file out level insize outsize millis mb/s +gob-stream zskp 1 1911399616 233948096 3230 564.34 +gob-stream zskp 2 1911399616 203997694 4997 364.73 +gob-stream zskp 3 1911399616 173526523 13435 135.68 +gob-stream zskp 4 1911399616 162195235 47559 38.33 + +gob-stream zstd 1 1911399616 249810424 2637 691.26 +gob-stream zstd 3 1911399616 208192146 3490 522.31 +gob-stream zstd 6 1911399616 193632038 6687 272.56 +gob-stream zstd 9 1911399616 177620386 16175 112.70 + +gob-stream gzstd 1 1911399616 357382013 9046 201.49 +gob-stream gzkp 1 1911399616 359136669 4885 373.08 + +The test data for the Large Text Compression Benchmark is the first +10^9 bytes of the English Wikipedia dump on Mar. 3, 2006. +http://mattmahoney.net/dc/textdata.html + +file out level insize outsize millis mb/s +enwik9 zskp 1 1000000000 343833605 3687 258.64 +enwik9 zskp 2 1000000000 317001237 7672 124.29 +enwik9 zskp 3 1000000000 291915823 15923 59.89 +enwik9 zskp 4 1000000000 261710291 77697 12.27 + +enwik9 zstd 1 1000000000 358072021 3110 306.65 +enwik9 zstd 3 1000000000 313734672 4784 199.35 +enwik9 zstd 6 1000000000 295138875 10290 92.68 +enwik9 zstd 9 1000000000 278348700 28549 33.40 + +enwik9 gzstd 1 1000000000 382578136 8608 110.78 +enwik9 gzkp 1 1000000000 382781160 5628 169.45 + +Highly compressible JSON file. +https://files.klauspost.com/compress/github-june-2days-2019.json.zst + +file out level insize outsize millis mb/s +github-june-2days-2019.json zskp 1 6273951764 697439532 9789 611.17 +github-june-2days-2019.json zskp 2 6273951764 610876538 18553 322.49 +github-june-2days-2019.json zskp 3 6273951764 517662858 44186 135.41 +github-june-2days-2019.json zskp 4 6273951764 464617114 165373 36.18 + +github-june-2days-2019.json zstd 1 6273951764 766284037 8450 708.00 +github-june-2days-2019.json zstd 3 6273951764 661889476 10927 547.57 +github-june-2days-2019.json zstd 6 6273951764 642756859 22996 260.18 +github-june-2days-2019.json zstd 9 6273951764 601974523 52413 114.16 + +github-june-2days-2019.json gzstd 1 6273951764 1164397768 26793 223.32 +github-june-2days-2019.json gzkp 1 6273951764 1120631856 17693 338.16 + +VM Image, Linux mint with a few installed applications: +https://files.klauspost.com/compress/rawstudio-mint14.7z + +file out level insize outsize millis mb/s +rawstudio-mint14.tar zskp 1 8558382592 3718400221 18206 448.29 +rawstudio-mint14.tar zskp 2 8558382592 3326118337 37074 220.15 +rawstudio-mint14.tar zskp 3 8558382592 3163842361 87306 93.49 +rawstudio-mint14.tar zskp 4 8558382592 2970480650 783862 10.41 + +rawstudio-mint14.tar zstd 1 8558382592 3609250104 17136 476.27 +rawstudio-mint14.tar zstd 3 8558382592 3341679997 29262 278.92 +rawstudio-mint14.tar zstd 6 8558382592 3235846406 77904 104.77 +rawstudio-mint14.tar zstd 9 8558382592 3160778861 140946 57.91 + +rawstudio-mint14.tar gzstd 1 8558382592 3926234992 51345 158.96 +rawstudio-mint14.tar gzkp 1 8558382592 3960117298 36722 222.26 + +CSV data: +https://files.klauspost.com/compress/nyc-taxi-data-10M.csv.zst + +file out level insize outsize millis mb/s +nyc-taxi-data-10M.csv zskp 1 3325605752 641319332 9462 335.17 +nyc-taxi-data-10M.csv zskp 2 3325605752 588976126 17570 180.50 +nyc-taxi-data-10M.csv zskp 3 3325605752 529329260 32432 97.79 +nyc-taxi-data-10M.csv zskp 4 3325605752 474949772 138025 22.98 + +nyc-taxi-data-10M.csv zstd 1 3325605752 687399637 8233 385.18 +nyc-taxi-data-10M.csv zstd 3 3325605752 598514411 10065 315.07 +nyc-taxi-data-10M.csv zstd 6 3325605752 570522953 20038 158.27 +nyc-taxi-data-10M.csv zstd 9 3325605752 517554797 64565 49.12 + +nyc-taxi-data-10M.csv gzstd 1 3325605752 928654908 21270 149.11 +nyc-taxi-data-10M.csv gzkp 1 3325605752 922273214 13929 227.68 +``` + +## Decompressor + +Staus: STABLE - there may still be subtle bugs, but a wide variety of content has been tested. + +This library is being continuously [fuzz-tested](https://github.com/klauspost/compress-fuzz), +kindly supplied by [fuzzit.dev](https://fuzzit.dev/). +The main purpose of the fuzz testing is to ensure that it is not possible to crash the decoder, +or run it past its limits with ANY input provided. + +### Usage + +The package has been designed for two main usages, big streams of data and smaller in-memory buffers. +There are two main usages of the package for these. Both of them are accessed by creating a `Decoder`. + +For streaming use a simple setup could look like this: + +```Go +import "github.com/klauspost/compress/zstd" + +func Decompress(in io.Reader, out io.Writer) error { + d, err := zstd.NewReader(in) + if err != nil { + return err + } + defer d.Close() + + // Copy content... + _, err = io.Copy(out, d) + return err +} +``` + +It is important to use the "Close" function when you no longer need the Reader to stop running goroutines, +when running with default settings. +Goroutines will exit once an error has been returned, including `io.EOF` at the end of a stream. + +Streams are decoded concurrently in 4 asynchronous stages to give the best possible throughput. +However, if you prefer synchronous decompression, use `WithDecoderConcurrency(1)` which will decompress data +as it is being requested only. + +For decoding buffers, it could look something like this: + +```Go +import "github.com/klauspost/compress/zstd" + +// Create a reader that caches decompressors. +// For this operation type we supply a nil Reader. +var decoder, _ = zstd.NewReader(nil, zstd.WithDecoderConcurrency(0)) + +// Decompress a buffer. We don't supply a destination buffer, +// so it will be allocated by the decoder. +func Decompress(src []byte) ([]byte, error) { + return decoder.DecodeAll(src, nil) +} +``` + +Both of these cases should provide the functionality needed. +The decoder can be used for *concurrent* decompression of multiple buffers. +By default 4 decompressors will be created. + +It will only allow a certain number of concurrent operations to run. +To tweak that yourself use the `WithDecoderConcurrency(n)` option when creating the decoder. +It is possible to use `WithDecoderConcurrency(0)` to create GOMAXPROCS decoders. + +### Dictionaries + +Data compressed with [dictionaries](https://github.com/facebook/zstd#the-case-for-small-data-compression) can be decompressed. + +Dictionaries are added individually to Decoders. +Dictionaries are generated by the `zstd --train` command and contains an initial state for the decoder. +To add a dictionary use the `WithDecoderDicts(dicts ...[]byte)` option with the dictionary data. +Several dictionaries can be added at once. + +The dictionary will be used automatically for the data that specifies them. +A re-used Decoder will still contain the dictionaries registered. + +When registering multiple dictionaries with the same ID, the last one will be used. + +It is possible to use dictionaries when compressing data. + +To enable a dictionary use `WithEncoderDict(dict []byte)`. Here only one dictionary will be used +and it will likely be used even if it doesn't improve compression. + +The used dictionary must be used to decompress the content. + +For any real gains, the dictionary should be built with similar data. +If an unsuitable dictionary is used the output may be slightly larger than using no dictionary. +Use the [zstd commandline tool](https://github.com/facebook/zstd/releases) to build a dictionary from sample data. +For information see [zstd dictionary information](https://github.com/facebook/zstd#the-case-for-small-data-compression). + +For now there is a fixed startup performance penalty for compressing content with dictionaries. +This will likely be improved over time. Just be aware to test performance when implementing. + +### Allocation-less operation + +The decoder has been designed to operate without allocations after a warmup. + +This means that you should *store* the decoder for best performance. +To re-use a stream decoder, use the `Reset(r io.Reader) error` to switch to another stream. +A decoder can safely be re-used even if the previous stream failed. + +To release the resources, you must call the `Close()` function on a decoder. +After this it can *no longer be reused*, but all running goroutines will be stopped. +So you *must* use this if you will no longer need the Reader. + +For decompressing smaller buffers a single decoder can be used. +When decoding buffers, you can supply a destination slice with length 0 and your expected capacity. +In this case no unneeded allocations should be made. + +### Concurrency + +The buffer decoder does everything on the same goroutine and does nothing concurrently. +It can however decode several buffers concurrently. Use `WithDecoderConcurrency(n)` to limit that. + +The stream decoder will create goroutines that: + +1) Reads input and splits the input into blocks. +2) Decompression of literals. +3) Decompression of sequences. +4) Reconstruction of output stream. + +So effectively this also means the decoder will "read ahead" and prepare data to always be available for output. + +The concurrency level will, for streams, determine how many blocks ahead the compression will start. + +Since "blocks" are quite dependent on the output of the previous block stream decoding will only have limited concurrency. + +In practice this means that concurrency is often limited to utilizing about 3 cores effectively. + +### Benchmarks + +The first two are streaming decodes and the last are smaller inputs. + +Running on AMD Ryzen 9 3950X 16-Core Processor. AMD64 assembly used. + +``` +BenchmarkDecoderSilesia-32 5 206878840 ns/op 1024.50 MB/s 49808 B/op 43 allocs/op +BenchmarkDecoderEnwik9-32 1 1271809000 ns/op 786.28 MB/s 72048 B/op 52 allocs/op + +Concurrent blocks, performance: + +BenchmarkDecoder_DecodeAllParallel/kppkn.gtb.zst-32 67356 17857 ns/op 10321.96 MB/s 22.48 pct 102 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/geo.protodata.zst-32 266656 4421 ns/op 26823.21 MB/s 11.89 pct 19 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/plrabn12.txt.zst-32 20992 56842 ns/op 8477.17 MB/s 39.90 pct 754 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/lcet10.txt.zst-32 27456 43932 ns/op 9714.01 MB/s 33.27 pct 524 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/asyoulik.txt.zst-32 78432 15047 ns/op 8319.15 MB/s 40.34 pct 66 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/alice29.txt.zst-32 65800 18436 ns/op 8249.63 MB/s 37.75 pct 88 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/html_x_4.zst-32 102993 11523 ns/op 35546.09 MB/s 3.637 pct 143 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/paper-100k.pdf.zst-32 1000000 1070 ns/op 95720.98 MB/s 80.53 pct 3 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/fireworks.jpeg.zst-32 749802 1752 ns/op 70272.35 MB/s 100.0 pct 5 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/urls.10K.zst-32 22640 52934 ns/op 13263.37 MB/s 26.25 pct 1014 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/html.zst-32 226412 5232 ns/op 19572.27 MB/s 14.49 pct 20 B/op 0 allocs/op +BenchmarkDecoder_DecodeAllParallel/comp-data.bin.zst-32 923041 1276 ns/op 3194.71 MB/s 31.26 pct 0 B/op 0 allocs/op +``` + +This reflects the performance around May 2022, but this may be out of date. + +## Zstd inside ZIP files + +It is possible to use zstandard to compress individual files inside zip archives. +While this isn't widely supported it can be useful for internal files. + +To support the compression and decompression of these files you must register a compressor and decompressor. + +It is highly recommended registering the (de)compressors on individual zip Reader/Writer and NOT +use the global registration functions. The main reason for this is that 2 registrations from +different packages will result in a panic. + +It is a good idea to only have a single compressor and decompressor, since they can be used for multiple zip +files concurrently, and using a single instance will allow reusing some resources. + +See [this example](https://pkg.go.dev/github.com/klauspost/compress/zstd#example-ZipCompressor) for +how to compress and decompress files inside zip archives. + +# Contributions + +Contributions are always welcome. +For new features/fixes, remember to add tests and for performance enhancements include benchmarks. + +For general feedback and experience reports, feel free to open an issue or write me on [Twitter](https://twitter.com/sh0dan). + +This package includes the excellent [`github.com/cespare/xxhash`](https://github.com/cespare/xxhash) package Copyright (c) 2016 Caleb Spare. diff --git a/vendor/github.com/klauspost/compress/zstd/bitreader.go b/vendor/github.com/klauspost/compress/zstd/bitreader.go new file mode 100644 index 000000000..97299d499 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/bitreader.go @@ -0,0 +1,140 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "encoding/binary" + "errors" + "fmt" + "io" + "math/bits" +) + +// bitReader reads a bitstream in reverse. +// The last set bit indicates the start of the stream and is used +// for aligning the input. +type bitReader struct { + in []byte + off uint // next byte to read is at in[off - 1] + value uint64 // Maybe use [16]byte, but shifting is awkward. + bitsRead uint8 +} + +// init initializes and resets the bit reader. +func (b *bitReader) init(in []byte) error { + if len(in) < 1 { + return errors.New("corrupt stream: too short") + } + b.in = in + b.off = uint(len(in)) + // The highest bit of the last byte indicates where to start + v := in[len(in)-1] + if v == 0 { + return errors.New("corrupt stream, did not find end of stream") + } + b.bitsRead = 64 + b.value = 0 + if len(in) >= 8 { + b.fillFastStart() + } else { + b.fill() + b.fill() + } + b.bitsRead += 8 - uint8(highBits(uint32(v))) + return nil +} + +// getBits will return n bits. n can be 0. +func (b *bitReader) getBits(n uint8) int { + if n == 0 /*|| b.bitsRead >= 64 */ { + return 0 + } + return int(b.get32BitsFast(n)) +} + +// get32BitsFast requires that at least one bit is requested every time. +// There are no checks if the buffer is filled. +func (b *bitReader) get32BitsFast(n uint8) uint32 { + const regMask = 64 - 1 + v := uint32((b.value << (b.bitsRead & regMask)) >> ((regMask + 1 - n) & regMask)) + b.bitsRead += n + return v +} + +// fillFast() will make sure at least 32 bits are available. +// There must be at least 4 bytes available. +func (b *bitReader) fillFast() { + if b.bitsRead < 32 { + return + } + // 2 bounds checks. + v := b.in[b.off-4:] + v = v[:4] + low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + b.value = (b.value << 32) | uint64(low) + b.bitsRead -= 32 + b.off -= 4 +} + +// fillFastStart() assumes the bitreader is empty and there is at least 8 bytes to read. +func (b *bitReader) fillFastStart() { + // Do single re-slice to avoid bounds checks. + b.value = binary.LittleEndian.Uint64(b.in[b.off-8:]) + b.bitsRead = 0 + b.off -= 8 +} + +// fill() will make sure at least 32 bits are available. +func (b *bitReader) fill() { + if b.bitsRead < 32 { + return + } + if b.off >= 4 { + v := b.in[b.off-4:] + v = v[:4] + low := (uint32(v[0])) | (uint32(v[1]) << 8) | (uint32(v[2]) << 16) | (uint32(v[3]) << 24) + b.value = (b.value << 32) | uint64(low) + b.bitsRead -= 32 + b.off -= 4 + return + } + for b.off > 0 { + b.value = (b.value << 8) | uint64(b.in[b.off-1]) + b.bitsRead -= 8 + b.off-- + } +} + +// finished returns true if all bits have been read from the bit stream. +func (b *bitReader) finished() bool { + return b.off == 0 && b.bitsRead >= 64 +} + +// overread returns true if more bits have been requested than is on the stream. +func (b *bitReader) overread() bool { + return b.bitsRead > 64 +} + +// remain returns the number of bits remaining. +func (b *bitReader) remain() uint { + return b.off*8 + 64 - uint(b.bitsRead) +} + +// close the bitstream and returns an error if out-of-buffer reads occurred. +func (b *bitReader) close() error { + // Release reference. + b.in = nil + if !b.finished() { + return fmt.Errorf("%d extra bits on block, should be 0", b.remain()) + } + if b.bitsRead > 64 { + return io.ErrUnexpectedEOF + } + return nil +} + +func highBits(val uint32) (n uint32) { + return uint32(bits.Len32(val) - 1) +} diff --git a/vendor/github.com/klauspost/compress/zstd/bitwriter.go b/vendor/github.com/klauspost/compress/zstd/bitwriter.go new file mode 100644 index 000000000..78b3c61be --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/bitwriter.go @@ -0,0 +1,113 @@ +// Copyright 2018 Klaus Post. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file. +// Based on work Copyright (c) 2013, Yann Collet, released under BSD License. + +package zstd + +// bitWriter will write bits. +// First bit will be LSB of the first byte of output. +type bitWriter struct { + bitContainer uint64 + nBits uint8 + out []byte +} + +// bitMask16 is bitmasks. Has extra to avoid bounds check. +var bitMask16 = [32]uint16{ + 0, 1, 3, 7, 0xF, 0x1F, + 0x3F, 0x7F, 0xFF, 0x1FF, 0x3FF, 0x7FF, + 0xFFF, 0x1FFF, 0x3FFF, 0x7FFF, 0xFFFF, 0xFFFF, + 0xFFFF, 0xFFFF, 0xFFFF, 0xFFFF, 0xFFFF, 0xFFFF, + 0xFFFF, 0xFFFF} /* up to 16 bits */ + +var bitMask32 = [32]uint32{ + 0, 1, 3, 7, 0xF, 0x1F, 0x3F, 0x7F, 0xFF, + 0x1FF, 0x3FF, 0x7FF, 0xFFF, 0x1FFF, 0x3FFF, 0x7FFF, 0xFFFF, + 0x1ffff, 0x3ffff, 0x7FFFF, 0xfFFFF, 0x1fFFFF, 0x3fFFFF, 0x7fFFFF, 0xffFFFF, + 0x1ffFFFF, 0x3ffFFFF, 0x7ffFFFF, 0xfffFFFF, 0x1fffFFFF, 0x3fffFFFF, 0x7fffFFFF, +} // up to 32 bits + +// addBits16NC will add up to 16 bits. +// It will not check if there is space for them, +// so the caller must ensure that it has flushed recently. +func (b *bitWriter) addBits16NC(value uint16, bits uint8) { + b.bitContainer |= uint64(value&bitMask16[bits&31]) << (b.nBits & 63) + b.nBits += bits +} + +// addBits32NC will add up to 31 bits. +// It will not check if there is space for them, +// so the caller must ensure that it has flushed recently. +func (b *bitWriter) addBits32NC(value uint32, bits uint8) { + b.bitContainer |= uint64(value&bitMask32[bits&31]) << (b.nBits & 63) + b.nBits += bits +} + +// addBits64NC will add up to 64 bits. +// There must be space for 32 bits. +func (b *bitWriter) addBits64NC(value uint64, bits uint8) { + if bits <= 31 { + b.addBits32Clean(uint32(value), bits) + return + } + b.addBits32Clean(uint32(value), 32) + b.flush32() + b.addBits32Clean(uint32(value>>32), bits-32) +} + +// addBits32Clean will add up to 32 bits. +// It will not check if there is space for them. +// The input must not contain more bits than specified. +func (b *bitWriter) addBits32Clean(value uint32, bits uint8) { + b.bitContainer |= uint64(value) << (b.nBits & 63) + b.nBits += bits +} + +// addBits16Clean will add up to 16 bits. value may not contain more set bits than indicated. +// It will not check if there is space for them, so the caller must ensure that it has flushed recently. +func (b *bitWriter) addBits16Clean(value uint16, bits uint8) { + b.bitContainer |= uint64(value) << (b.nBits & 63) + b.nBits += bits +} + +// flush32 will flush out, so there are at least 32 bits available for writing. +func (b *bitWriter) flush32() { + if b.nBits < 32 { + return + } + b.out = append(b.out, + byte(b.bitContainer), + byte(b.bitContainer>>8), + byte(b.bitContainer>>16), + byte(b.bitContainer>>24)) + b.nBits -= 32 + b.bitContainer >>= 32 +} + +// flushAlign will flush remaining full bytes and align to next byte boundary. +func (b *bitWriter) flushAlign() { + nbBytes := (b.nBits + 7) >> 3 + for i := uint8(0); i < nbBytes; i++ { + b.out = append(b.out, byte(b.bitContainer>>(i*8))) + } + b.nBits = 0 + b.bitContainer = 0 +} + +// close will write the alignment bit and write the final byte(s) +// to the output. +func (b *bitWriter) close() error { + // End mark + b.addBits16Clean(1, 1) + // flush until next byte. + b.flushAlign() + return nil +} + +// reset and continue writing by appending to out. +func (b *bitWriter) reset(out []byte) { + b.bitContainer = 0 + b.nBits = 0 + b.out = out +} diff --git a/vendor/github.com/klauspost/compress/zstd/blockdec.go b/vendor/github.com/klauspost/compress/zstd/blockdec.go new file mode 100644 index 000000000..9f17ce601 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/blockdec.go @@ -0,0 +1,726 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "bytes" + "encoding/binary" + "errors" + "fmt" + "hash/crc32" + "io" + "os" + "path/filepath" + "sync" + + "github.com/klauspost/compress/huff0" + "github.com/klauspost/compress/zstd/internal/xxhash" +) + +type blockType uint8 + +//go:generate stringer -type=blockType,literalsBlockType,seqCompMode,tableIndex + +const ( + blockTypeRaw blockType = iota + blockTypeRLE + blockTypeCompressed + blockTypeReserved +) + +type literalsBlockType uint8 + +const ( + literalsBlockRaw literalsBlockType = iota + literalsBlockRLE + literalsBlockCompressed + literalsBlockTreeless +) + +const ( + // maxCompressedBlockSize is the biggest allowed compressed block size (128KB) + maxCompressedBlockSize = 128 << 10 + + compressedBlockOverAlloc = 16 + maxCompressedBlockSizeAlloc = 128<<10 + compressedBlockOverAlloc + + // Maximum possible block size (all Raw+Uncompressed). + maxBlockSize = (1 << 21) - 1 + + maxMatchLen = 131074 + maxSequences = 0x7f00 + 0xffff + + // We support slightly less than the reference decoder to be able to + // use ints on 32 bit archs. + maxOffsetBits = 30 +) + +var ( + huffDecoderPool = sync.Pool{New: func() interface{} { + return &huff0.Scratch{} + }} + + fseDecoderPool = sync.Pool{New: func() interface{} { + return &fseDecoder{} + }} +) + +type blockDec struct { + // Raw source data of the block. + data []byte + dataStorage []byte + + // Destination of the decoded data. + dst []byte + + // Buffer for literals data. + literalBuf []byte + + // Window size of the block. + WindowSize uint64 + + err error + + // Check against this crc, if hasCRC is true. + checkCRC uint32 + hasCRC bool + + // Frame to use for singlethreaded decoding. + // Should not be used by the decoder itself since parent may be another frame. + localFrame *frameDec + + sequence []seqVals + + async struct { + newHist *history + literals []byte + seqData []byte + seqSize int // Size of uncompressed sequences + fcs uint64 + } + + // Block is RLE, this is the size. + RLESize uint32 + + Type blockType + + // Is this the last block of a frame? + Last bool + + // Use less memory + lowMem bool +} + +func (b *blockDec) String() string { + if b == nil { + return "" + } + return fmt.Sprintf("Steam Size: %d, Type: %v, Last: %t, Window: %d", len(b.data), b.Type, b.Last, b.WindowSize) +} + +func newBlockDec(lowMem bool) *blockDec { + b := blockDec{ + lowMem: lowMem, + } + return &b +} + +// reset will reset the block. +// Input must be a start of a block and will be at the end of the block when returned. +func (b *blockDec) reset(br byteBuffer, windowSize uint64) error { + b.WindowSize = windowSize + tmp, err := br.readSmall(3) + if err != nil { + println("Reading block header:", err) + return err + } + bh := uint32(tmp[0]) | (uint32(tmp[1]) << 8) | (uint32(tmp[2]) << 16) + b.Last = bh&1 != 0 + b.Type = blockType((bh >> 1) & 3) + // find size. + cSize := int(bh >> 3) + maxSize := maxCompressedBlockSizeAlloc + switch b.Type { + case blockTypeReserved: + return ErrReservedBlockType + case blockTypeRLE: + if cSize > maxCompressedBlockSize || cSize > int(b.WindowSize) { + if debugDecoder { + printf("rle block too big: csize:%d block: %+v\n", uint64(cSize), b) + } + return ErrWindowSizeExceeded + } + b.RLESize = uint32(cSize) + if b.lowMem { + maxSize = cSize + } + cSize = 1 + case blockTypeCompressed: + if debugDecoder { + println("Data size on stream:", cSize) + } + b.RLESize = 0 + maxSize = maxCompressedBlockSizeAlloc + if windowSize < maxCompressedBlockSize && b.lowMem { + maxSize = int(windowSize) + compressedBlockOverAlloc + } + if cSize > maxCompressedBlockSize || uint64(cSize) > b.WindowSize { + if debugDecoder { + printf("compressed block too big: csize:%d block: %+v\n", uint64(cSize), b) + } + return ErrCompressedSizeTooBig + } + // Empty compressed blocks must at least be 2 bytes + // for Literals_Block_Type and one for Sequences_Section_Header. + if cSize < 2 { + return ErrBlockTooSmall + } + case blockTypeRaw: + if cSize > maxCompressedBlockSize || cSize > int(b.WindowSize) { + if debugDecoder { + printf("rle block too big: csize:%d block: %+v\n", uint64(cSize), b) + } + return ErrWindowSizeExceeded + } + + b.RLESize = 0 + // We do not need a destination for raw blocks. + maxSize = -1 + default: + panic("Invalid block type") + } + + // Read block data. + if _, ok := br.(*byteBuf); !ok && cap(b.dataStorage) < cSize { + // byteBuf doesn't need a destination buffer. + if b.lowMem || cSize > maxCompressedBlockSize { + b.dataStorage = make([]byte, 0, cSize+compressedBlockOverAlloc) + } else { + b.dataStorage = make([]byte, 0, maxCompressedBlockSizeAlloc) + } + } + b.data, err = br.readBig(cSize, b.dataStorage) + if err != nil { + if debugDecoder { + println("Reading block:", err, "(", cSize, ")", len(b.data)) + printf("%T", br) + } + return err + } + if cap(b.dst) <= maxSize { + b.dst = make([]byte, 0, maxSize+1) + } + return nil +} + +// sendEOF will make the decoder send EOF on this frame. +func (b *blockDec) sendErr(err error) { + b.Last = true + b.Type = blockTypeReserved + b.err = err +} + +// Close will release resources. +// Closed blockDec cannot be reset. +func (b *blockDec) Close() { +} + +// decodeBuf +func (b *blockDec) decodeBuf(hist *history) error { + switch b.Type { + case blockTypeRLE: + if cap(b.dst) < int(b.RLESize) { + if b.lowMem { + b.dst = make([]byte, b.RLESize) + } else { + b.dst = make([]byte, maxCompressedBlockSize) + } + } + b.dst = b.dst[:b.RLESize] + v := b.data[0] + for i := range b.dst { + b.dst[i] = v + } + hist.appendKeep(b.dst) + return nil + case blockTypeRaw: + hist.appendKeep(b.data) + return nil + case blockTypeCompressed: + saved := b.dst + // Append directly to history + if hist.ignoreBuffer == 0 { + b.dst = hist.b + hist.b = nil + } else { + b.dst = b.dst[:0] + } + err := b.decodeCompressed(hist) + if debugDecoder { + println("Decompressed to total", len(b.dst), "bytes, hash:", xxhash.Sum64(b.dst), "error:", err) + } + if hist.ignoreBuffer == 0 { + hist.b = b.dst + b.dst = saved + } else { + hist.appendKeep(b.dst) + } + return err + case blockTypeReserved: + // Used for returning errors. + return b.err + default: + panic("Invalid block type") + } +} + +func (b *blockDec) decodeLiterals(in []byte, hist *history) (remain []byte, err error) { + // There must be at least one byte for Literals_Block_Type and one for Sequences_Section_Header + if len(in) < 2 { + return in, ErrBlockTooSmall + } + + litType := literalsBlockType(in[0] & 3) + var litRegenSize int + var litCompSize int + sizeFormat := (in[0] >> 2) & 3 + var fourStreams bool + var literals []byte + switch litType { + case literalsBlockRaw, literalsBlockRLE: + switch sizeFormat { + case 0, 2: + // Regenerated_Size uses 5 bits (0-31). Literals_Section_Header uses 1 byte. + litRegenSize = int(in[0] >> 3) + in = in[1:] + case 1: + // Regenerated_Size uses 12 bits (0-4095). Literals_Section_Header uses 2 bytes. + litRegenSize = int(in[0]>>4) + (int(in[1]) << 4) + in = in[2:] + case 3: + // Regenerated_Size uses 20 bits (0-1048575). Literals_Section_Header uses 3 bytes. + if len(in) < 3 { + println("too small: litType:", litType, " sizeFormat", sizeFormat, len(in)) + return in, ErrBlockTooSmall + } + litRegenSize = int(in[0]>>4) + (int(in[1]) << 4) + (int(in[2]) << 12) + in = in[3:] + } + case literalsBlockCompressed, literalsBlockTreeless: + switch sizeFormat { + case 0, 1: + // Both Regenerated_Size and Compressed_Size use 10 bits (0-1023). + if len(in) < 3 { + println("too small: litType:", litType, " sizeFormat", sizeFormat, len(in)) + return in, ErrBlockTooSmall + } + n := uint64(in[0]>>4) + (uint64(in[1]) << 4) + (uint64(in[2]) << 12) + litRegenSize = int(n & 1023) + litCompSize = int(n >> 10) + fourStreams = sizeFormat == 1 + in = in[3:] + case 2: + fourStreams = true + if len(in) < 4 { + println("too small: litType:", litType, " sizeFormat", sizeFormat, len(in)) + return in, ErrBlockTooSmall + } + n := uint64(in[0]>>4) + (uint64(in[1]) << 4) + (uint64(in[2]) << 12) + (uint64(in[3]) << 20) + litRegenSize = int(n & 16383) + litCompSize = int(n >> 14) + in = in[4:] + case 3: + fourStreams = true + if len(in) < 5 { + println("too small: litType:", litType, " sizeFormat", sizeFormat, len(in)) + return in, ErrBlockTooSmall + } + n := uint64(in[0]>>4) + (uint64(in[1]) << 4) + (uint64(in[2]) << 12) + (uint64(in[3]) << 20) + (uint64(in[4]) << 28) + litRegenSize = int(n & 262143) + litCompSize = int(n >> 18) + in = in[5:] + } + } + if debugDecoder { + println("literals type:", litType, "litRegenSize:", litRegenSize, "litCompSize:", litCompSize, "sizeFormat:", sizeFormat, "4X:", fourStreams) + } + if litRegenSize > int(b.WindowSize) || litRegenSize > maxCompressedBlockSize { + return in, ErrWindowSizeExceeded + } + + switch litType { + case literalsBlockRaw: + if len(in) < litRegenSize { + println("too small: litType:", litType, " sizeFormat", sizeFormat, "remain:", len(in), "want:", litRegenSize) + return in, ErrBlockTooSmall + } + literals = in[:litRegenSize] + in = in[litRegenSize:] + //printf("Found %d uncompressed literals\n", litRegenSize) + case literalsBlockRLE: + if len(in) < 1 { + println("too small: litType:", litType, " sizeFormat", sizeFormat, "remain:", len(in), "want:", 1) + return in, ErrBlockTooSmall + } + if cap(b.literalBuf) < litRegenSize { + if b.lowMem { + b.literalBuf = make([]byte, litRegenSize, litRegenSize+compressedBlockOverAlloc) + } else { + b.literalBuf = make([]byte, litRegenSize, maxCompressedBlockSize+compressedBlockOverAlloc) + } + } + literals = b.literalBuf[:litRegenSize] + v := in[0] + for i := range literals { + literals[i] = v + } + in = in[1:] + if debugDecoder { + printf("Found %d RLE compressed literals\n", litRegenSize) + } + case literalsBlockTreeless: + if len(in) < litCompSize { + println("too small: litType:", litType, " sizeFormat", sizeFormat, "remain:", len(in), "want:", litCompSize) + return in, ErrBlockTooSmall + } + // Store compressed literals, so we defer decoding until we get history. + literals = in[:litCompSize] + in = in[litCompSize:] + if debugDecoder { + printf("Found %d compressed literals\n", litCompSize) + } + huff := hist.huffTree + if huff == nil { + return in, errors.New("literal block was treeless, but no history was defined") + } + // Ensure we have space to store it. + if cap(b.literalBuf) < litRegenSize { + if b.lowMem { + b.literalBuf = make([]byte, 0, litRegenSize+compressedBlockOverAlloc) + } else { + b.literalBuf = make([]byte, 0, maxCompressedBlockSize+compressedBlockOverAlloc) + } + } + var err error + // Use our out buffer. + huff.MaxDecodedSize = litRegenSize + if fourStreams { + literals, err = huff.Decoder().Decompress4X(b.literalBuf[:0:litRegenSize], literals) + } else { + literals, err = huff.Decoder().Decompress1X(b.literalBuf[:0:litRegenSize], literals) + } + // Make sure we don't leak our literals buffer + if err != nil { + println("decompressing literals:", err) + return in, err + } + if len(literals) != litRegenSize { + return in, fmt.Errorf("literal output size mismatch want %d, got %d", litRegenSize, len(literals)) + } + + case literalsBlockCompressed: + if len(in) < litCompSize { + println("too small: litType:", litType, " sizeFormat", sizeFormat, "remain:", len(in), "want:", litCompSize) + return in, ErrBlockTooSmall + } + literals = in[:litCompSize] + in = in[litCompSize:] + // Ensure we have space to store it. + if cap(b.literalBuf) < litRegenSize { + if b.lowMem { + b.literalBuf = make([]byte, 0, litRegenSize+compressedBlockOverAlloc) + } else { + b.literalBuf = make([]byte, 0, maxCompressedBlockSize+compressedBlockOverAlloc) + } + } + huff := hist.huffTree + if huff == nil || (hist.dict != nil && huff == hist.dict.litEnc) { + huff = huffDecoderPool.Get().(*huff0.Scratch) + if huff == nil { + huff = &huff0.Scratch{} + } + } + var err error + if debugDecoder { + println("huff table input:", len(literals), "CRC:", crc32.ChecksumIEEE(literals)) + } + huff, literals, err = huff0.ReadTable(literals, huff) + if err != nil { + println("reading huffman table:", err) + return in, err + } + hist.huffTree = huff + huff.MaxDecodedSize = litRegenSize + // Use our out buffer. + if fourStreams { + literals, err = huff.Decoder().Decompress4X(b.literalBuf[:0:litRegenSize], literals) + } else { + literals, err = huff.Decoder().Decompress1X(b.literalBuf[:0:litRegenSize], literals) + } + if err != nil { + println("decoding compressed literals:", err) + return in, err + } + // Make sure we don't leak our literals buffer + if len(literals) != litRegenSize { + return in, fmt.Errorf("literal output size mismatch want %d, got %d", litRegenSize, len(literals)) + } + // Re-cap to get extra size. + literals = b.literalBuf[:len(literals)] + if debugDecoder { + printf("Decompressed %d literals into %d bytes\n", litCompSize, litRegenSize) + } + } + hist.decoders.literals = literals + return in, nil +} + +// decodeCompressed will start decompressing a block. +func (b *blockDec) decodeCompressed(hist *history) error { + in := b.data + in, err := b.decodeLiterals(in, hist) + if err != nil { + return err + } + err = b.prepareSequences(in, hist) + if err != nil { + return err + } + if hist.decoders.nSeqs == 0 { + b.dst = append(b.dst, hist.decoders.literals...) + return nil + } + before := len(hist.decoders.out) + err = hist.decoders.decodeSync(hist.b[hist.ignoreBuffer:]) + if err != nil { + return err + } + if hist.decoders.maxSyncLen > 0 { + hist.decoders.maxSyncLen += uint64(before) + hist.decoders.maxSyncLen -= uint64(len(hist.decoders.out)) + } + b.dst = hist.decoders.out + hist.recentOffsets = hist.decoders.prevOffset + return nil +} + +func (b *blockDec) prepareSequences(in []byte, hist *history) (err error) { + if debugDecoder { + printf("prepareSequences: %d byte(s) input\n", len(in)) + } + // Decode Sequences + // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#sequences-section + if len(in) < 1 { + return ErrBlockTooSmall + } + var nSeqs int + seqHeader := in[0] + switch { + case seqHeader < 128: + nSeqs = int(seqHeader) + in = in[1:] + case seqHeader < 255: + if len(in) < 2 { + return ErrBlockTooSmall + } + nSeqs = int(seqHeader-128)<<8 | int(in[1]) + in = in[2:] + case seqHeader == 255: + if len(in) < 3 { + return ErrBlockTooSmall + } + nSeqs = 0x7f00 + int(in[1]) + (int(in[2]) << 8) + in = in[3:] + } + if nSeqs == 0 && len(in) != 0 { + // When no sequences, there should not be any more data... + if debugDecoder { + printf("prepareSequences: 0 sequences, but %d byte(s) left on stream\n", len(in)) + } + return ErrUnexpectedBlockSize + } + + var seqs = &hist.decoders + seqs.nSeqs = nSeqs + if nSeqs > 0 { + if len(in) < 1 { + return ErrBlockTooSmall + } + br := byteReader{b: in, off: 0} + compMode := br.Uint8() + br.advance(1) + if debugDecoder { + printf("Compression modes: 0b%b", compMode) + } + for i := uint(0); i < 3; i++ { + mode := seqCompMode((compMode >> (6 - i*2)) & 3) + if debugDecoder { + println("Table", tableIndex(i), "is", mode) + } + var seq *sequenceDec + switch tableIndex(i) { + case tableLiteralLengths: + seq = &seqs.litLengths + case tableOffsets: + seq = &seqs.offsets + case tableMatchLengths: + seq = &seqs.matchLengths + default: + panic("unknown table") + } + switch mode { + case compModePredefined: + if seq.fse != nil && !seq.fse.preDefined { + fseDecoderPool.Put(seq.fse) + } + seq.fse = &fsePredef[i] + case compModeRLE: + if br.remain() < 1 { + return ErrBlockTooSmall + } + v := br.Uint8() + br.advance(1) + if seq.fse == nil || seq.fse.preDefined { + seq.fse = fseDecoderPool.Get().(*fseDecoder) + } + symb, err := decSymbolValue(v, symbolTableX[i]) + if err != nil { + printf("RLE Transform table (%v) error: %v", tableIndex(i), err) + return err + } + seq.fse.setRLE(symb) + if debugDecoder { + printf("RLE set to 0x%x, code: %v", symb, v) + } + case compModeFSE: + println("Reading table for", tableIndex(i)) + if seq.fse == nil || seq.fse.preDefined { + seq.fse = fseDecoderPool.Get().(*fseDecoder) + } + err := seq.fse.readNCount(&br, uint16(maxTableSymbol[i])) + if err != nil { + println("Read table error:", err) + return err + } + err = seq.fse.transform(symbolTableX[i]) + if err != nil { + println("Transform table error:", err) + return err + } + if debugDecoder { + println("Read table ok", "symbolLen:", seq.fse.symbolLen) + } + case compModeRepeat: + seq.repeat = true + } + if br.overread() { + return io.ErrUnexpectedEOF + } + } + in = br.unread() + } + if debugDecoder { + println("Literals:", len(seqs.literals), "hash:", xxhash.Sum64(seqs.literals), "and", seqs.nSeqs, "sequences.") + } + + if nSeqs == 0 { + if len(b.sequence) > 0 { + b.sequence = b.sequence[:0] + } + return nil + } + br := seqs.br + if br == nil { + br = &bitReader{} + } + if err := br.init(in); err != nil { + return err + } + + if err := seqs.initialize(br, hist, b.dst); err != nil { + println("initializing sequences:", err) + return err + } + // Extract blocks... + if false && hist.dict == nil { + fatalErr := func(err error) { + if err != nil { + panic(err) + } + } + fn := fmt.Sprintf("n-%d-lits-%d-prev-%d-%d-%d-win-%d.blk", hist.decoders.nSeqs, len(hist.decoders.literals), hist.recentOffsets[0], hist.recentOffsets[1], hist.recentOffsets[2], hist.windowSize) + var buf bytes.Buffer + fatalErr(binary.Write(&buf, binary.LittleEndian, hist.decoders.litLengths.fse)) + fatalErr(binary.Write(&buf, binary.LittleEndian, hist.decoders.matchLengths.fse)) + fatalErr(binary.Write(&buf, binary.LittleEndian, hist.decoders.offsets.fse)) + buf.Write(in) + os.WriteFile(filepath.Join("testdata", "seqs", fn), buf.Bytes(), os.ModePerm) + } + + return nil +} + +func (b *blockDec) decodeSequences(hist *history) error { + if cap(b.sequence) < hist.decoders.nSeqs { + if b.lowMem { + b.sequence = make([]seqVals, 0, hist.decoders.nSeqs) + } else { + b.sequence = make([]seqVals, 0, 0x7F00+0xffff) + } + } + b.sequence = b.sequence[:hist.decoders.nSeqs] + if hist.decoders.nSeqs == 0 { + hist.decoders.seqSize = len(hist.decoders.literals) + return nil + } + hist.decoders.windowSize = hist.windowSize + hist.decoders.prevOffset = hist.recentOffsets + + err := hist.decoders.decode(b.sequence) + hist.recentOffsets = hist.decoders.prevOffset + return err +} + +func (b *blockDec) executeSequences(hist *history) error { + hbytes := hist.b + if len(hbytes) > hist.windowSize { + hbytes = hbytes[len(hbytes)-hist.windowSize:] + // We do not need history anymore. + if hist.dict != nil { + hist.dict.content = nil + } + } + hist.decoders.windowSize = hist.windowSize + hist.decoders.out = b.dst[:0] + err := hist.decoders.execute(b.sequence, hbytes) + if err != nil { + return err + } + return b.updateHistory(hist) +} + +func (b *blockDec) updateHistory(hist *history) error { + if len(b.data) > maxCompressedBlockSize { + return fmt.Errorf("compressed block size too large (%d)", len(b.data)) + } + // Set output and release references. + b.dst = hist.decoders.out + hist.recentOffsets = hist.decoders.prevOffset + + if b.Last { + // if last block we don't care about history. + println("Last block, no history returned") + hist.b = hist.b[:0] + return nil + } else { + hist.append(b.dst) + if debugDecoder { + println("Finished block with ", len(b.sequence), "sequences. Added", len(b.dst), "to history, now length", len(hist.b)) + } + } + hist.decoders.out, hist.decoders.literals = nil, nil + + return nil +} diff --git a/vendor/github.com/klauspost/compress/zstd/blockenc.go b/vendor/github.com/klauspost/compress/zstd/blockenc.go new file mode 100644 index 000000000..fd4a36f73 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/blockenc.go @@ -0,0 +1,874 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "errors" + "fmt" + "math" + "math/bits" + + "github.com/klauspost/compress/huff0" +) + +type blockEnc struct { + size int + literals []byte + sequences []seq + coders seqCoders + litEnc *huff0.Scratch + dictLitEnc *huff0.Scratch + wr bitWriter + + extraLits int + output []byte + recentOffsets [3]uint32 + prevRecentOffsets [3]uint32 + + last bool + lowMem bool +} + +// init should be used once the block has been created. +// If called more than once, the effect is the same as calling reset. +func (b *blockEnc) init() { + if b.lowMem { + // 1K literals + if cap(b.literals) < 1<<10 { + b.literals = make([]byte, 0, 1<<10) + } + const defSeqs = 20 + if cap(b.sequences) < defSeqs { + b.sequences = make([]seq, 0, defSeqs) + } + // 1K + if cap(b.output) < 1<<10 { + b.output = make([]byte, 0, 1<<10) + } + } else { + if cap(b.literals) < maxCompressedBlockSize { + b.literals = make([]byte, 0, maxCompressedBlockSize) + } + const defSeqs = 2000 + if cap(b.sequences) < defSeqs { + b.sequences = make([]seq, 0, defSeqs) + } + if cap(b.output) < maxCompressedBlockSize { + b.output = make([]byte, 0, maxCompressedBlockSize) + } + } + + if b.coders.mlEnc == nil { + b.coders.mlEnc = &fseEncoder{} + b.coders.mlPrev = &fseEncoder{} + b.coders.ofEnc = &fseEncoder{} + b.coders.ofPrev = &fseEncoder{} + b.coders.llEnc = &fseEncoder{} + b.coders.llPrev = &fseEncoder{} + } + b.litEnc = &huff0.Scratch{WantLogLess: 4} + b.reset(nil) +} + +// initNewEncode can be used to reset offsets and encoders to the initial state. +func (b *blockEnc) initNewEncode() { + b.recentOffsets = [3]uint32{1, 4, 8} + b.litEnc.Reuse = huff0.ReusePolicyNone + b.coders.setPrev(nil, nil, nil) +} + +// reset will reset the block for a new encode, but in the same stream, +// meaning that state will be carried over, but the block content is reset. +// If a previous block is provided, the recent offsets are carried over. +func (b *blockEnc) reset(prev *blockEnc) { + b.extraLits = 0 + b.literals = b.literals[:0] + b.size = 0 + b.sequences = b.sequences[:0] + b.output = b.output[:0] + b.last = false + if prev != nil { + b.recentOffsets = prev.prevRecentOffsets + } + b.dictLitEnc = nil +} + +// reset will reset the block for a new encode, but in the same stream, +// meaning that state will be carried over, but the block content is reset. +// If a previous block is provided, the recent offsets are carried over. +func (b *blockEnc) swapEncoders(prev *blockEnc) { + b.coders.swap(&prev.coders) + b.litEnc, prev.litEnc = prev.litEnc, b.litEnc +} + +// blockHeader contains the information for a block header. +type blockHeader uint32 + +// setLast sets the 'last' indicator on a block. +func (h *blockHeader) setLast(b bool) { + if b { + *h = *h | 1 + } else { + const mask = (1 << 24) - 2 + *h = *h & mask + } +} + +// setSize will store the compressed size of a block. +func (h *blockHeader) setSize(v uint32) { + const mask = 7 + *h = (*h)&mask | blockHeader(v<<3) +} + +// setType sets the block type. +func (h *blockHeader) setType(t blockType) { + const mask = 1 | (((1 << 24) - 1) ^ 7) + *h = (*h & mask) | blockHeader(t<<1) +} + +// appendTo will append the block header to a slice. +func (h blockHeader) appendTo(b []byte) []byte { + return append(b, uint8(h), uint8(h>>8), uint8(h>>16)) +} + +// String returns a string representation of the block. +func (h blockHeader) String() string { + return fmt.Sprintf("Type: %d, Size: %d, Last:%t", (h>>1)&3, h>>3, h&1 == 1) +} + +// literalsHeader contains literals header information. +type literalsHeader uint64 + +// setType can be used to set the type of literal block. +func (h *literalsHeader) setType(t literalsBlockType) { + const mask = math.MaxUint64 - 3 + *h = (*h & mask) | literalsHeader(t) +} + +// setSize can be used to set a single size, for uncompressed and RLE content. +func (h *literalsHeader) setSize(regenLen int) { + inBits := bits.Len32(uint32(regenLen)) + // Only retain 2 bits + const mask = 3 + lh := uint64(*h & mask) + switch { + case inBits < 5: + lh |= (uint64(regenLen) << 3) | (1 << 60) + if debugEncoder { + got := int(lh>>3) & 0xff + if got != regenLen { + panic(fmt.Sprint("litRegenSize = ", regenLen, "(want) != ", got, "(got)")) + } + } + case inBits < 12: + lh |= (1 << 2) | (uint64(regenLen) << 4) | (2 << 60) + case inBits < 20: + lh |= (3 << 2) | (uint64(regenLen) << 4) | (3 << 60) + default: + panic(fmt.Errorf("internal error: block too big (%d)", regenLen)) + } + *h = literalsHeader(lh) +} + +// setSizes will set the size of a compressed literals section and the input length. +func (h *literalsHeader) setSizes(compLen, inLen int, single bool) { + compBits, inBits := bits.Len32(uint32(compLen)), bits.Len32(uint32(inLen)) + // Only retain 2 bits + const mask = 3 + lh := uint64(*h & mask) + switch { + case compBits <= 10 && inBits <= 10: + if !single { + lh |= 1 << 2 + } + lh |= (uint64(inLen) << 4) | (uint64(compLen) << (10 + 4)) | (3 << 60) + if debugEncoder { + const mmask = (1 << 24) - 1 + n := (lh >> 4) & mmask + if int(n&1023) != inLen { + panic(fmt.Sprint("regensize:", int(n&1023), "!=", inLen, inBits)) + } + if int(n>>10) != compLen { + panic(fmt.Sprint("compsize:", int(n>>10), "!=", compLen, compBits)) + } + } + case compBits <= 14 && inBits <= 14: + lh |= (2 << 2) | (uint64(inLen) << 4) | (uint64(compLen) << (14 + 4)) | (4 << 60) + if single { + panic("single stream used with more than 10 bits length.") + } + case compBits <= 18 && inBits <= 18: + lh |= (3 << 2) | (uint64(inLen) << 4) | (uint64(compLen) << (18 + 4)) | (5 << 60) + if single { + panic("single stream used with more than 10 bits length.") + } + default: + panic("internal error: block too big") + } + *h = literalsHeader(lh) +} + +// appendTo will append the literals header to a byte slice. +func (h literalsHeader) appendTo(b []byte) []byte { + size := uint8(h >> 60) + switch size { + case 1: + b = append(b, uint8(h)) + case 2: + b = append(b, uint8(h), uint8(h>>8)) + case 3: + b = append(b, uint8(h), uint8(h>>8), uint8(h>>16)) + case 4: + b = append(b, uint8(h), uint8(h>>8), uint8(h>>16), uint8(h>>24)) + case 5: + b = append(b, uint8(h), uint8(h>>8), uint8(h>>16), uint8(h>>24), uint8(h>>32)) + default: + panic(fmt.Errorf("internal error: literalsHeader has invalid size (%d)", size)) + } + return b +} + +// size returns the output size with currently set values. +func (h literalsHeader) size() int { + return int(h >> 60) +} + +func (h literalsHeader) String() string { + return fmt.Sprintf("Type: %d, SizeFormat: %d, Size: 0x%d, Bytes:%d", literalsBlockType(h&3), (h>>2)&3, h&((1<<60)-1)>>4, h>>60) +} + +// pushOffsets will push the recent offsets to the backup store. +func (b *blockEnc) pushOffsets() { + b.prevRecentOffsets = b.recentOffsets +} + +// pushOffsets will push the recent offsets to the backup store. +func (b *blockEnc) popOffsets() { + b.recentOffsets = b.prevRecentOffsets +} + +// matchOffset will adjust recent offsets and return the adjusted one, +// if it matches a previous offset. +func (b *blockEnc) matchOffset(offset, lits uint32) uint32 { + // Check if offset is one of the recent offsets. + // Adjusts the output offset accordingly. + // Gives a tiny bit of compression, typically around 1%. + if true { + if lits > 0 { + switch offset { + case b.recentOffsets[0]: + offset = 1 + case b.recentOffsets[1]: + b.recentOffsets[1] = b.recentOffsets[0] + b.recentOffsets[0] = offset + offset = 2 + case b.recentOffsets[2]: + b.recentOffsets[2] = b.recentOffsets[1] + b.recentOffsets[1] = b.recentOffsets[0] + b.recentOffsets[0] = offset + offset = 3 + default: + b.recentOffsets[2] = b.recentOffsets[1] + b.recentOffsets[1] = b.recentOffsets[0] + b.recentOffsets[0] = offset + offset += 3 + } + } else { + switch offset { + case b.recentOffsets[1]: + b.recentOffsets[1] = b.recentOffsets[0] + b.recentOffsets[0] = offset + offset = 1 + case b.recentOffsets[2]: + b.recentOffsets[2] = b.recentOffsets[1] + b.recentOffsets[1] = b.recentOffsets[0] + b.recentOffsets[0] = offset + offset = 2 + case b.recentOffsets[0] - 1: + b.recentOffsets[2] = b.recentOffsets[1] + b.recentOffsets[1] = b.recentOffsets[0] + b.recentOffsets[0] = offset + offset = 3 + default: + b.recentOffsets[2] = b.recentOffsets[1] + b.recentOffsets[1] = b.recentOffsets[0] + b.recentOffsets[0] = offset + offset += 3 + } + } + } else { + offset += 3 + } + return offset +} + +// encodeRaw can be used to set the output to a raw representation of supplied bytes. +func (b *blockEnc) encodeRaw(a []byte) { + var bh blockHeader + bh.setLast(b.last) + bh.setSize(uint32(len(a))) + bh.setType(blockTypeRaw) + b.output = bh.appendTo(b.output[:0]) + b.output = append(b.output, a...) + if debugEncoder { + println("Adding RAW block, length", len(a), "last:", b.last) + } +} + +// encodeRaw can be used to set the output to a raw representation of supplied bytes. +func (b *blockEnc) encodeRawTo(dst, src []byte) []byte { + var bh blockHeader + bh.setLast(b.last) + bh.setSize(uint32(len(src))) + bh.setType(blockTypeRaw) + dst = bh.appendTo(dst) + dst = append(dst, src...) + if debugEncoder { + println("Adding RAW block, length", len(src), "last:", b.last) + } + return dst +} + +// encodeLits can be used if the block is only litLen. +func (b *blockEnc) encodeLits(lits []byte, raw bool) error { + var bh blockHeader + bh.setLast(b.last) + bh.setSize(uint32(len(lits))) + + // Don't compress extremely small blocks + if len(lits) < 8 || (len(lits) < 32 && b.dictLitEnc == nil) || raw { + if debugEncoder { + println("Adding RAW block, length", len(lits), "last:", b.last) + } + bh.setType(blockTypeRaw) + b.output = bh.appendTo(b.output) + b.output = append(b.output, lits...) + return nil + } + + var ( + out []byte + reUsed, single bool + err error + ) + if b.dictLitEnc != nil { + b.litEnc.TransferCTable(b.dictLitEnc) + b.litEnc.Reuse = huff0.ReusePolicyAllow + b.dictLitEnc = nil + } + if len(lits) >= 1024 { + // Use 4 Streams. + out, reUsed, err = huff0.Compress4X(lits, b.litEnc) + } else if len(lits) > 32 { + // Use 1 stream + single = true + out, reUsed, err = huff0.Compress1X(lits, b.litEnc) + } else { + err = huff0.ErrIncompressible + } + + switch err { + case huff0.ErrIncompressible: + if debugEncoder { + println("Adding RAW block, length", len(lits), "last:", b.last) + } + bh.setType(blockTypeRaw) + b.output = bh.appendTo(b.output) + b.output = append(b.output, lits...) + return nil + case huff0.ErrUseRLE: + if debugEncoder { + println("Adding RLE block, length", len(lits)) + } + bh.setType(blockTypeRLE) + b.output = bh.appendTo(b.output) + b.output = append(b.output, lits[0]) + return nil + case nil: + default: + return err + } + // Compressed... + // Now, allow reuse + b.litEnc.Reuse = huff0.ReusePolicyAllow + bh.setType(blockTypeCompressed) + var lh literalsHeader + if reUsed { + if debugEncoder { + println("Reused tree, compressed to", len(out)) + } + lh.setType(literalsBlockTreeless) + } else { + if debugEncoder { + println("New tree, compressed to", len(out), "tree size:", len(b.litEnc.OutTable)) + } + lh.setType(literalsBlockCompressed) + } + // Set sizes + lh.setSizes(len(out), len(lits), single) + bh.setSize(uint32(len(out) + lh.size() + 1)) + + // Write block headers. + b.output = bh.appendTo(b.output) + b.output = lh.appendTo(b.output) + // Add compressed data. + b.output = append(b.output, out...) + // No sequences. + b.output = append(b.output, 0) + return nil +} + +// fuzzFseEncoder can be used to fuzz the FSE encoder. +func fuzzFseEncoder(data []byte) int { + if len(data) > maxSequences || len(data) < 2 { + return 0 + } + enc := fseEncoder{} + hist := enc.Histogram() + maxSym := uint8(0) + for i, v := range data { + v = v & 63 + data[i] = v + hist[v]++ + if v > maxSym { + maxSym = v + } + } + if maxSym == 0 { + // All 0 + return 0 + } + maxCount := func(a []uint32) int { + var max uint32 + for _, v := range a { + if v > max { + max = v + } + } + return int(max) + } + cnt := maxCount(hist[:maxSym]) + if cnt == len(data) { + // RLE + return 0 + } + enc.HistogramFinished(maxSym, cnt) + err := enc.normalizeCount(len(data)) + if err != nil { + return 0 + } + _, err = enc.writeCount(nil) + if err != nil { + panic(err) + } + return 1 +} + +// encode will encode the block and append the output in b.output. +// Previous offset codes must be pushed if more blocks are expected. +func (b *blockEnc) encode(org []byte, raw, rawAllLits bool) error { + if len(b.sequences) == 0 { + return b.encodeLits(b.literals, rawAllLits) + } + // We want some difference to at least account for the headers. + saved := b.size - len(b.literals) - (b.size >> 6) + if saved < 16 { + if org == nil { + return errIncompressible + } + b.popOffsets() + return b.encodeLits(org, rawAllLits) + } + + var bh blockHeader + var lh literalsHeader + bh.setLast(b.last) + bh.setType(blockTypeCompressed) + // Store offset of the block header. Needed when we know the size. + bhOffset := len(b.output) + b.output = bh.appendTo(b.output) + + var ( + out []byte + reUsed, single bool + err error + ) + if b.dictLitEnc != nil { + b.litEnc.TransferCTable(b.dictLitEnc) + b.litEnc.Reuse = huff0.ReusePolicyAllow + b.dictLitEnc = nil + } + if len(b.literals) >= 1024 && !raw { + // Use 4 Streams. + out, reUsed, err = huff0.Compress4X(b.literals, b.litEnc) + } else if len(b.literals) > 32 && !raw { + // Use 1 stream + single = true + out, reUsed, err = huff0.Compress1X(b.literals, b.litEnc) + } else { + err = huff0.ErrIncompressible + } + + switch err { + case huff0.ErrIncompressible: + lh.setType(literalsBlockRaw) + lh.setSize(len(b.literals)) + b.output = lh.appendTo(b.output) + b.output = append(b.output, b.literals...) + if debugEncoder { + println("Adding literals RAW, length", len(b.literals)) + } + case huff0.ErrUseRLE: + lh.setType(literalsBlockRLE) + lh.setSize(len(b.literals)) + b.output = lh.appendTo(b.output) + b.output = append(b.output, b.literals[0]) + if debugEncoder { + println("Adding literals RLE") + } + case nil: + // Compressed litLen... + if reUsed { + if debugEncoder { + println("reused tree") + } + lh.setType(literalsBlockTreeless) + } else { + if debugEncoder { + println("new tree, size:", len(b.litEnc.OutTable)) + } + lh.setType(literalsBlockCompressed) + if debugEncoder { + _, _, err := huff0.ReadTable(out, nil) + if err != nil { + panic(err) + } + } + } + lh.setSizes(len(out), len(b.literals), single) + if debugEncoder { + printf("Compressed %d literals to %d bytes", len(b.literals), len(out)) + println("Adding literal header:", lh) + } + b.output = lh.appendTo(b.output) + b.output = append(b.output, out...) + b.litEnc.Reuse = huff0.ReusePolicyAllow + if debugEncoder { + println("Adding literals compressed") + } + default: + if debugEncoder { + println("Adding literals ERROR:", err) + } + return err + } + // Sequence compression + + // Write the number of sequences + switch { + case len(b.sequences) < 128: + b.output = append(b.output, uint8(len(b.sequences))) + case len(b.sequences) < 0x7f00: // TODO: this could be wrong + n := len(b.sequences) + b.output = append(b.output, 128+uint8(n>>8), uint8(n)) + default: + n := len(b.sequences) - 0x7f00 + b.output = append(b.output, 255, uint8(n), uint8(n>>8)) + } + if debugEncoder { + println("Encoding", len(b.sequences), "sequences") + } + b.genCodes() + llEnc := b.coders.llEnc + ofEnc := b.coders.ofEnc + mlEnc := b.coders.mlEnc + err = llEnc.normalizeCount(len(b.sequences)) + if err != nil { + return err + } + err = ofEnc.normalizeCount(len(b.sequences)) + if err != nil { + return err + } + err = mlEnc.normalizeCount(len(b.sequences)) + if err != nil { + return err + } + + // Choose the best compression mode for each type. + // Will evaluate the new vs predefined and previous. + chooseComp := func(cur, prev, preDef *fseEncoder) (*fseEncoder, seqCompMode) { + // See if predefined/previous is better + hist := cur.count[:cur.symbolLen] + nSize := cur.approxSize(hist) + cur.maxHeaderSize() + predefSize := preDef.approxSize(hist) + prevSize := prev.approxSize(hist) + + // Add a small penalty for new encoders. + // Don't bother with extremely small (<2 byte gains). + nSize = nSize + (nSize+2*8*16)>>4 + switch { + case predefSize <= prevSize && predefSize <= nSize || forcePreDef: + if debugEncoder { + println("Using predefined", predefSize>>3, "<=", nSize>>3) + } + return preDef, compModePredefined + case prevSize <= nSize: + if debugEncoder { + println("Using previous", prevSize>>3, "<=", nSize>>3) + } + return prev, compModeRepeat + default: + if debugEncoder { + println("Using new, predef", predefSize>>3, ". previous:", prevSize>>3, ">", nSize>>3, "header max:", cur.maxHeaderSize()>>3, "bytes") + println("tl:", cur.actualTableLog, "symbolLen:", cur.symbolLen, "norm:", cur.norm[:cur.symbolLen], "hist", cur.count[:cur.symbolLen]) + } + return cur, compModeFSE + } + } + + // Write compression mode + var mode uint8 + if llEnc.useRLE { + mode |= uint8(compModeRLE) << 6 + llEnc.setRLE(b.sequences[0].llCode) + if debugEncoder { + println("llEnc.useRLE") + } + } else { + var m seqCompMode + llEnc, m = chooseComp(llEnc, b.coders.llPrev, &fsePredefEnc[tableLiteralLengths]) + mode |= uint8(m) << 6 + } + if ofEnc.useRLE { + mode |= uint8(compModeRLE) << 4 + ofEnc.setRLE(b.sequences[0].ofCode) + if debugEncoder { + println("ofEnc.useRLE") + } + } else { + var m seqCompMode + ofEnc, m = chooseComp(ofEnc, b.coders.ofPrev, &fsePredefEnc[tableOffsets]) + mode |= uint8(m) << 4 + } + + if mlEnc.useRLE { + mode |= uint8(compModeRLE) << 2 + mlEnc.setRLE(b.sequences[0].mlCode) + if debugEncoder { + println("mlEnc.useRLE, code: ", b.sequences[0].mlCode, "value", b.sequences[0].matchLen) + } + } else { + var m seqCompMode + mlEnc, m = chooseComp(mlEnc, b.coders.mlPrev, &fsePredefEnc[tableMatchLengths]) + mode |= uint8(m) << 2 + } + b.output = append(b.output, mode) + if debugEncoder { + printf("Compression modes: 0b%b", mode) + } + b.output, err = llEnc.writeCount(b.output) + if err != nil { + return err + } + start := len(b.output) + b.output, err = ofEnc.writeCount(b.output) + if err != nil { + return err + } + if false { + println("block:", b.output[start:], "tablelog", ofEnc.actualTableLog, "maxcount:", ofEnc.maxCount) + fmt.Printf("selected TableLog: %d, Symbol length: %d\n", ofEnc.actualTableLog, ofEnc.symbolLen) + for i, v := range ofEnc.norm[:ofEnc.symbolLen] { + fmt.Printf("%3d: %5d -> %4d \n", i, ofEnc.count[i], v) + } + } + b.output, err = mlEnc.writeCount(b.output) + if err != nil { + return err + } + + // Maybe in block? + wr := &b.wr + wr.reset(b.output) + + var ll, of, ml cState + + // Current sequence + seq := len(b.sequences) - 1 + s := b.sequences[seq] + llEnc.setBits(llBitsTable[:]) + mlEnc.setBits(mlBitsTable[:]) + ofEnc.setBits(nil) + + llTT, ofTT, mlTT := llEnc.ct.symbolTT[:256], ofEnc.ct.symbolTT[:256], mlEnc.ct.symbolTT[:256] + + // We have 3 bounds checks here (and in the loop). + // Since we are iterating backwards it is kinda hard to avoid. + llB, ofB, mlB := llTT[s.llCode], ofTT[s.ofCode], mlTT[s.mlCode] + ll.init(wr, &llEnc.ct, llB) + of.init(wr, &ofEnc.ct, ofB) + wr.flush32() + ml.init(wr, &mlEnc.ct, mlB) + + // Each of these lookups also generates a bounds check. + wr.addBits32NC(s.litLen, llB.outBits) + wr.addBits32NC(s.matchLen, mlB.outBits) + wr.flush32() + wr.addBits32NC(s.offset, ofB.outBits) + if debugSequences { + println("Encoded seq", seq, s, "codes:", s.llCode, s.mlCode, s.ofCode, "states:", ll.state, ml.state, of.state, "bits:", llB, mlB, ofB) + } + seq-- + // Store sequences in reverse... + for seq >= 0 { + s = b.sequences[seq] + + ofB := ofTT[s.ofCode] + wr.flush32() // tablelog max is below 8 for each, so it will fill max 24 bits. + //of.encode(ofB) + nbBitsOut := (uint32(of.state) + ofB.deltaNbBits) >> 16 + dstState := int32(of.state>>(nbBitsOut&15)) + int32(ofB.deltaFindState) + wr.addBits16NC(of.state, uint8(nbBitsOut)) + of.state = of.stateTable[dstState] + + // Accumulate extra bits. + outBits := ofB.outBits & 31 + extraBits := uint64(s.offset & bitMask32[outBits]) + extraBitsN := outBits + + mlB := mlTT[s.mlCode] + //ml.encode(mlB) + nbBitsOut = (uint32(ml.state) + mlB.deltaNbBits) >> 16 + dstState = int32(ml.state>>(nbBitsOut&15)) + int32(mlB.deltaFindState) + wr.addBits16NC(ml.state, uint8(nbBitsOut)) + ml.state = ml.stateTable[dstState] + + outBits = mlB.outBits & 31 + extraBits = extraBits<> 16 + dstState = int32(ll.state>>(nbBitsOut&15)) + int32(llB.deltaFindState) + wr.addBits16NC(ll.state, uint8(nbBitsOut)) + ll.state = ll.stateTable[dstState] + + outBits = llB.outBits & 31 + extraBits = extraBits<= b.size { + // Discard and encode as raw block. + b.output = b.encodeRawTo(b.output[:bhOffset], org) + b.popOffsets() + b.litEnc.Reuse = huff0.ReusePolicyNone + return nil + } + + // Size is output minus block header. + bh.setSize(uint32(len(b.output)-bhOffset) - 3) + if debugEncoder { + println("Rewriting block header", bh) + } + _ = bh.appendTo(b.output[bhOffset:bhOffset]) + b.coders.setPrev(llEnc, mlEnc, ofEnc) + return nil +} + +var errIncompressible = errors.New("incompressible") + +func (b *blockEnc) genCodes() { + if len(b.sequences) == 0 { + // nothing to do + return + } + if len(b.sequences) > math.MaxUint16 { + panic("can only encode up to 64K sequences") + } + // No bounds checks after here: + llH := b.coders.llEnc.Histogram() + ofH := b.coders.ofEnc.Histogram() + mlH := b.coders.mlEnc.Histogram() + for i := range llH { + llH[i] = 0 + } + for i := range ofH { + ofH[i] = 0 + } + for i := range mlH { + mlH[i] = 0 + } + + var llMax, ofMax, mlMax uint8 + for i := range b.sequences { + seq := &b.sequences[i] + v := llCode(seq.litLen) + seq.llCode = v + llH[v]++ + if v > llMax { + llMax = v + } + + v = ofCode(seq.offset) + seq.ofCode = v + ofH[v]++ + if v > ofMax { + ofMax = v + } + + v = mlCode(seq.matchLen) + seq.mlCode = v + mlH[v]++ + if v > mlMax { + mlMax = v + if debugAsserts && mlMax > maxMatchLengthSymbol { + panic(fmt.Errorf("mlMax > maxMatchLengthSymbol (%d), matchlen: %d", mlMax, seq.matchLen)) + } + } + } + maxCount := func(a []uint32) int { + var max uint32 + for _, v := range a { + if v > max { + max = v + } + } + return int(max) + } + if debugAsserts && mlMax > maxMatchLengthSymbol { + panic(fmt.Errorf("mlMax > maxMatchLengthSymbol (%d)", mlMax)) + } + if debugAsserts && ofMax > maxOffsetBits { + panic(fmt.Errorf("ofMax > maxOffsetBits (%d)", ofMax)) + } + if debugAsserts && llMax > maxLiteralLengthSymbol { + panic(fmt.Errorf("llMax > maxLiteralLengthSymbol (%d)", llMax)) + } + + b.coders.mlEnc.HistogramFinished(mlMax, maxCount(mlH[:mlMax+1])) + b.coders.ofEnc.HistogramFinished(ofMax, maxCount(ofH[:ofMax+1])) + b.coders.llEnc.HistogramFinished(llMax, maxCount(llH[:llMax+1])) +} diff --git a/vendor/github.com/klauspost/compress/zstd/blocktype_string.go b/vendor/github.com/klauspost/compress/zstd/blocktype_string.go new file mode 100644 index 000000000..01a01e486 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/blocktype_string.go @@ -0,0 +1,85 @@ +// Code generated by "stringer -type=blockType,literalsBlockType,seqCompMode,tableIndex"; DO NOT EDIT. + +package zstd + +import "strconv" + +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[blockTypeRaw-0] + _ = x[blockTypeRLE-1] + _ = x[blockTypeCompressed-2] + _ = x[blockTypeReserved-3] +} + +const _blockType_name = "blockTypeRawblockTypeRLEblockTypeCompressedblockTypeReserved" + +var _blockType_index = [...]uint8{0, 12, 24, 43, 60} + +func (i blockType) String() string { + if i >= blockType(len(_blockType_index)-1) { + return "blockType(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _blockType_name[_blockType_index[i]:_blockType_index[i+1]] +} +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[literalsBlockRaw-0] + _ = x[literalsBlockRLE-1] + _ = x[literalsBlockCompressed-2] + _ = x[literalsBlockTreeless-3] +} + +const _literalsBlockType_name = "literalsBlockRawliteralsBlockRLEliteralsBlockCompressedliteralsBlockTreeless" + +var _literalsBlockType_index = [...]uint8{0, 16, 32, 55, 76} + +func (i literalsBlockType) String() string { + if i >= literalsBlockType(len(_literalsBlockType_index)-1) { + return "literalsBlockType(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _literalsBlockType_name[_literalsBlockType_index[i]:_literalsBlockType_index[i+1]] +} +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[compModePredefined-0] + _ = x[compModeRLE-1] + _ = x[compModeFSE-2] + _ = x[compModeRepeat-3] +} + +const _seqCompMode_name = "compModePredefinedcompModeRLEcompModeFSEcompModeRepeat" + +var _seqCompMode_index = [...]uint8{0, 18, 29, 40, 54} + +func (i seqCompMode) String() string { + if i >= seqCompMode(len(_seqCompMode_index)-1) { + return "seqCompMode(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _seqCompMode_name[_seqCompMode_index[i]:_seqCompMode_index[i+1]] +} +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[tableLiteralLengths-0] + _ = x[tableOffsets-1] + _ = x[tableMatchLengths-2] +} + +const _tableIndex_name = "tableLiteralLengthstableOffsetstableMatchLengths" + +var _tableIndex_index = [...]uint8{0, 19, 31, 48} + +func (i tableIndex) String() string { + if i >= tableIndex(len(_tableIndex_index)-1) { + return "tableIndex(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _tableIndex_name[_tableIndex_index[i]:_tableIndex_index[i+1]] +} diff --git a/vendor/github.com/klauspost/compress/zstd/bytebuf.go b/vendor/github.com/klauspost/compress/zstd/bytebuf.go new file mode 100644 index 000000000..55a388553 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/bytebuf.go @@ -0,0 +1,131 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "fmt" + "io" +) + +type byteBuffer interface { + // Read up to 8 bytes. + // Returns io.ErrUnexpectedEOF if this cannot be satisfied. + readSmall(n int) ([]byte, error) + + // Read >8 bytes. + // MAY use the destination slice. + readBig(n int, dst []byte) ([]byte, error) + + // Read a single byte. + readByte() (byte, error) + + // Skip n bytes. + skipN(n int64) error +} + +// in-memory buffer +type byteBuf []byte + +func (b *byteBuf) readSmall(n int) ([]byte, error) { + if debugAsserts && n > 8 { + panic(fmt.Errorf("small read > 8 (%d). use readBig", n)) + } + bb := *b + if len(bb) < n { + return nil, io.ErrUnexpectedEOF + } + r := bb[:n] + *b = bb[n:] + return r, nil +} + +func (b *byteBuf) readBig(n int, dst []byte) ([]byte, error) { + bb := *b + if len(bb) < n { + return nil, io.ErrUnexpectedEOF + } + r := bb[:n] + *b = bb[n:] + return r, nil +} + +func (b *byteBuf) readByte() (byte, error) { + bb := *b + if len(bb) < 1 { + return 0, io.ErrUnexpectedEOF + } + r := bb[0] + *b = bb[1:] + return r, nil +} + +func (b *byteBuf) skipN(n int64) error { + bb := *b + if n < 0 { + return fmt.Errorf("negative skip (%d) requested", n) + } + if int64(len(bb)) < n { + return io.ErrUnexpectedEOF + } + *b = bb[n:] + return nil +} + +// wrapper around a reader. +type readerWrapper struct { + r io.Reader + tmp [8]byte +} + +func (r *readerWrapper) readSmall(n int) ([]byte, error) { + if debugAsserts && n > 8 { + panic(fmt.Errorf("small read > 8 (%d). use readBig", n)) + } + n2, err := io.ReadFull(r.r, r.tmp[:n]) + // We only really care about the actual bytes read. + if err != nil { + if err == io.EOF { + return nil, io.ErrUnexpectedEOF + } + if debugDecoder { + println("readSmall: got", n2, "want", n, "err", err) + } + return nil, err + } + return r.tmp[:n], nil +} + +func (r *readerWrapper) readBig(n int, dst []byte) ([]byte, error) { + if cap(dst) < n { + dst = make([]byte, n) + } + n2, err := io.ReadFull(r.r, dst[:n]) + if err == io.EOF && n > 0 { + err = io.ErrUnexpectedEOF + } + return dst[:n2], err +} + +func (r *readerWrapper) readByte() (byte, error) { + n2, err := io.ReadFull(r.r, r.tmp[:1]) + if err != nil { + if err == io.EOF { + err = io.ErrUnexpectedEOF + } + return 0, err + } + if n2 != 1 { + return 0, io.ErrUnexpectedEOF + } + return r.tmp[0], nil +} + +func (r *readerWrapper) skipN(n int64) error { + n2, err := io.CopyN(io.Discard, r.r, n) + if n2 != n { + err = io.ErrUnexpectedEOF + } + return err +} diff --git a/vendor/github.com/klauspost/compress/zstd/bytereader.go b/vendor/github.com/klauspost/compress/zstd/bytereader.go new file mode 100644 index 000000000..0e59a242d --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/bytereader.go @@ -0,0 +1,82 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +// byteReader provides a byte reader that reads +// little endian values from a byte stream. +// The input stream is manually advanced. +// The reader performs no bounds checks. +type byteReader struct { + b []byte + off int +} + +// advance the stream b n bytes. +func (b *byteReader) advance(n uint) { + b.off += int(n) +} + +// overread returns whether we have advanced too far. +func (b *byteReader) overread() bool { + return b.off > len(b.b) +} + +// Int32 returns a little endian int32 starting at current offset. +func (b byteReader) Int32() int32 { + b2 := b.b[b.off:] + b2 = b2[:4] + v3 := int32(b2[3]) + v2 := int32(b2[2]) + v1 := int32(b2[1]) + v0 := int32(b2[0]) + return v0 | (v1 << 8) | (v2 << 16) | (v3 << 24) +} + +// Uint8 returns the next byte +func (b *byteReader) Uint8() uint8 { + v := b.b[b.off] + return v +} + +// Uint32 returns a little endian uint32 starting at current offset. +func (b byteReader) Uint32() uint32 { + if r := b.remain(); r < 4 { + // Very rare + v := uint32(0) + for i := 1; i <= r; i++ { + v = (v << 8) | uint32(b.b[len(b.b)-i]) + } + return v + } + b2 := b.b[b.off:] + b2 = b2[:4] + v3 := uint32(b2[3]) + v2 := uint32(b2[2]) + v1 := uint32(b2[1]) + v0 := uint32(b2[0]) + return v0 | (v1 << 8) | (v2 << 16) | (v3 << 24) +} + +// Uint32NC returns a little endian uint32 starting at current offset. +// The caller must be sure if there are at least 4 bytes left. +func (b byteReader) Uint32NC() uint32 { + b2 := b.b[b.off:] + b2 = b2[:4] + v3 := uint32(b2[3]) + v2 := uint32(b2[2]) + v1 := uint32(b2[1]) + v0 := uint32(b2[0]) + return v0 | (v1 << 8) | (v2 << 16) | (v3 << 24) +} + +// unread returns the unread portion of the input. +func (b byteReader) unread() []byte { + return b.b[b.off:] +} + +// remain will return the number of bytes remaining. +func (b byteReader) remain() int { + return len(b.b) - b.off +} diff --git a/vendor/github.com/klauspost/compress/zstd/decodeheader.go b/vendor/github.com/klauspost/compress/zstd/decodeheader.go new file mode 100644 index 000000000..f6a240970 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/decodeheader.go @@ -0,0 +1,229 @@ +// Copyright 2020+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. + +package zstd + +import ( + "encoding/binary" + "errors" + "io" +) + +// HeaderMaxSize is the maximum size of a Frame and Block Header. +// If less is sent to Header.Decode it *may* still contain enough information. +const HeaderMaxSize = 14 + 3 + +// Header contains information about the first frame and block within that. +type Header struct { + // SingleSegment specifies whether the data is to be decompressed into a + // single contiguous memory segment. + // It implies that WindowSize is invalid and that FrameContentSize is valid. + SingleSegment bool + + // WindowSize is the window of data to keep while decoding. + // Will only be set if SingleSegment is false. + WindowSize uint64 + + // Dictionary ID. + // If 0, no dictionary. + DictionaryID uint32 + + // HasFCS specifies whether FrameContentSize has a valid value. + HasFCS bool + + // FrameContentSize is the expected uncompressed size of the entire frame. + FrameContentSize uint64 + + // Skippable will be true if the frame is meant to be skipped. + // This implies that FirstBlock.OK is false. + Skippable bool + + // SkippableID is the user-specific ID for the skippable frame. + // Valid values are between 0 to 15, inclusive. + SkippableID int + + // SkippableSize is the length of the user data to skip following + // the header. + SkippableSize uint32 + + // HeaderSize is the raw size of the frame header. + // + // For normal frames, it includes the size of the magic number and + // the size of the header (per section 3.1.1.1). + // It does not include the size for any data blocks (section 3.1.1.2) nor + // the size for the trailing content checksum. + // + // For skippable frames, this counts the size of the magic number + // along with the size of the size field of the payload. + // It does not include the size of the skippable payload itself. + // The total frame size is the HeaderSize plus the SkippableSize. + HeaderSize int + + // First block information. + FirstBlock struct { + // OK will be set if first block could be decoded. + OK bool + + // Is this the last block of a frame? + Last bool + + // Is the data compressed? + // If true CompressedSize will be populated. + // Unfortunately DecompressedSize cannot be determined + // without decoding the blocks. + Compressed bool + + // DecompressedSize is the expected decompressed size of the block. + // Will be 0 if it cannot be determined. + DecompressedSize int + + // CompressedSize of the data in the block. + // Does not include the block header. + // Will be equal to DecompressedSize if not Compressed. + CompressedSize int + } + + // If set there is a checksum present for the block content. + // The checksum field at the end is always 4 bytes long. + HasCheckSum bool +} + +// Decode the header from the beginning of the stream. +// This will decode the frame header and the first block header if enough bytes are provided. +// It is recommended to provide at least HeaderMaxSize bytes. +// If the frame header cannot be read an error will be returned. +// If there isn't enough input, io.ErrUnexpectedEOF is returned. +// The FirstBlock.OK will indicate if enough information was available to decode the first block header. +func (h *Header) Decode(in []byte) error { + *h = Header{} + if len(in) < 4 { + return io.ErrUnexpectedEOF + } + h.HeaderSize += 4 + b, in := in[:4], in[4:] + if string(b) != frameMagic { + if string(b[1:4]) != skippableFrameMagic || b[0]&0xf0 != 0x50 { + return ErrMagicMismatch + } + if len(in) < 4 { + return io.ErrUnexpectedEOF + } + h.HeaderSize += 4 + h.Skippable = true + h.SkippableID = int(b[0] & 0xf) + h.SkippableSize = binary.LittleEndian.Uint32(in) + return nil + } + + // Read Window_Descriptor + // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#window_descriptor + if len(in) < 1 { + return io.ErrUnexpectedEOF + } + fhd, in := in[0], in[1:] + h.HeaderSize++ + h.SingleSegment = fhd&(1<<5) != 0 + h.HasCheckSum = fhd&(1<<2) != 0 + if fhd&(1<<3) != 0 { + return errors.New("reserved bit set on frame header") + } + + if !h.SingleSegment { + if len(in) < 1 { + return io.ErrUnexpectedEOF + } + var wd byte + wd, in = in[0], in[1:] + h.HeaderSize++ + windowLog := 10 + (wd >> 3) + windowBase := uint64(1) << windowLog + windowAdd := (windowBase / 8) * uint64(wd&0x7) + h.WindowSize = windowBase + windowAdd + } + + // Read Dictionary_ID + // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#dictionary_id + if size := fhd & 3; size != 0 { + if size == 3 { + size = 4 + } + if len(in) < int(size) { + return io.ErrUnexpectedEOF + } + b, in = in[:size], in[size:] + h.HeaderSize += int(size) + switch len(b) { + case 1: + h.DictionaryID = uint32(b[0]) + case 2: + h.DictionaryID = uint32(b[0]) | (uint32(b[1]) << 8) + case 4: + h.DictionaryID = uint32(b[0]) | (uint32(b[1]) << 8) | (uint32(b[2]) << 16) | (uint32(b[3]) << 24) + } + } + + // Read Frame_Content_Size + // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#frame_content_size + var fcsSize int + v := fhd >> 6 + switch v { + case 0: + if h.SingleSegment { + fcsSize = 1 + } + default: + fcsSize = 1 << v + } + + if fcsSize > 0 { + h.HasFCS = true + if len(in) < fcsSize { + return io.ErrUnexpectedEOF + } + b, in = in[:fcsSize], in[fcsSize:] + h.HeaderSize += int(fcsSize) + switch len(b) { + case 1: + h.FrameContentSize = uint64(b[0]) + case 2: + // When FCS_Field_Size is 2, the offset of 256 is added. + h.FrameContentSize = uint64(b[0]) | (uint64(b[1]) << 8) + 256 + case 4: + h.FrameContentSize = uint64(b[0]) | (uint64(b[1]) << 8) | (uint64(b[2]) << 16) | (uint64(b[3]) << 24) + case 8: + d1 := uint32(b[0]) | (uint32(b[1]) << 8) | (uint32(b[2]) << 16) | (uint32(b[3]) << 24) + d2 := uint32(b[4]) | (uint32(b[5]) << 8) | (uint32(b[6]) << 16) | (uint32(b[7]) << 24) + h.FrameContentSize = uint64(d1) | (uint64(d2) << 32) + } + } + + // Frame Header done, we will not fail from now on. + if len(in) < 3 { + return nil + } + tmp := in[:3] + bh := uint32(tmp[0]) | (uint32(tmp[1]) << 8) | (uint32(tmp[2]) << 16) + h.FirstBlock.Last = bh&1 != 0 + blockType := blockType((bh >> 1) & 3) + // find size. + cSize := int(bh >> 3) + switch blockType { + case blockTypeReserved: + return nil + case blockTypeRLE: + h.FirstBlock.Compressed = true + h.FirstBlock.DecompressedSize = cSize + h.FirstBlock.CompressedSize = 1 + case blockTypeCompressed: + h.FirstBlock.Compressed = true + h.FirstBlock.CompressedSize = cSize + case blockTypeRaw: + h.FirstBlock.DecompressedSize = cSize + h.FirstBlock.CompressedSize = cSize + default: + panic("Invalid block type") + } + + h.FirstBlock.OK = true + return nil +} diff --git a/vendor/github.com/klauspost/compress/zstd/decoder.go b/vendor/github.com/klauspost/compress/zstd/decoder.go new file mode 100644 index 000000000..f04aaa21e --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/decoder.go @@ -0,0 +1,948 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "context" + "encoding/binary" + "io" + "sync" + + "github.com/klauspost/compress/zstd/internal/xxhash" +) + +// Decoder provides decoding of zstandard streams. +// The decoder has been designed to operate without allocations after a warmup. +// This means that you should store the decoder for best performance. +// To re-use a stream decoder, use the Reset(r io.Reader) error to switch to another stream. +// A decoder can safely be re-used even if the previous stream failed. +// To release the resources, you must call the Close() function on a decoder. +type Decoder struct { + o decoderOptions + + // Unreferenced decoders, ready for use. + decoders chan *blockDec + + // Current read position used for Reader functionality. + current decoderState + + // sync stream decoding + syncStream struct { + decodedFrame uint64 + br readerWrapper + enabled bool + inFrame bool + dstBuf []byte + } + + frame *frameDec + + // Custom dictionaries. + dicts map[uint32]*dict + + // streamWg is the waitgroup for all streams + streamWg sync.WaitGroup +} + +// decoderState is used for maintaining state when the decoder +// is used for streaming. +type decoderState struct { + // current block being written to stream. + decodeOutput + + // output in order to be written to stream. + output chan decodeOutput + + // cancel remaining output. + cancel context.CancelFunc + + // crc of current frame + crc *xxhash.Digest + + flushed bool +} + +var ( + // Check the interfaces we want to support. + _ = io.WriterTo(&Decoder{}) + _ = io.Reader(&Decoder{}) +) + +// NewReader creates a new decoder. +// A nil Reader can be provided in which case Reset can be used to start a decode. +// +// A Decoder can be used in two modes: +// +// 1) As a stream, or +// 2) For stateless decoding using DecodeAll. +// +// Only a single stream can be decoded concurrently, but the same decoder +// can run multiple concurrent stateless decodes. It is even possible to +// use stateless decodes while a stream is being decoded. +// +// The Reset function can be used to initiate a new stream, which is will considerably +// reduce the allocations normally caused by NewReader. +func NewReader(r io.Reader, opts ...DOption) (*Decoder, error) { + initPredefined() + var d Decoder + d.o.setDefault() + for _, o := range opts { + err := o(&d.o) + if err != nil { + return nil, err + } + } + d.current.crc = xxhash.New() + d.current.flushed = true + + if r == nil { + d.current.err = ErrDecoderNilInput + } + + // Transfer option dicts. + d.dicts = make(map[uint32]*dict, len(d.o.dicts)) + for _, dc := range d.o.dicts { + d.dicts[dc.id] = dc + } + d.o.dicts = nil + + // Create decoders + d.decoders = make(chan *blockDec, d.o.concurrent) + for i := 0; i < d.o.concurrent; i++ { + dec := newBlockDec(d.o.lowMem) + dec.localFrame = newFrameDec(d.o) + d.decoders <- dec + } + + if r == nil { + return &d, nil + } + return &d, d.Reset(r) +} + +// Read bytes from the decompressed stream into p. +// Returns the number of bytes written and any error that occurred. +// When the stream is done, io.EOF will be returned. +func (d *Decoder) Read(p []byte) (int, error) { + var n int + for { + if len(d.current.b) > 0 { + filled := copy(p, d.current.b) + p = p[filled:] + d.current.b = d.current.b[filled:] + n += filled + } + if len(p) == 0 { + break + } + if len(d.current.b) == 0 { + // We have an error and no more data + if d.current.err != nil { + break + } + if !d.nextBlock(n == 0) { + return n, d.current.err + } + } + } + if len(d.current.b) > 0 { + if debugDecoder { + println("returning", n, "still bytes left:", len(d.current.b)) + } + // Only return error at end of block + return n, nil + } + if d.current.err != nil { + d.drainOutput() + } + if debugDecoder { + println("returning", n, d.current.err, len(d.decoders)) + } + return n, d.current.err +} + +// Reset will reset the decoder the supplied stream after the current has finished processing. +// Note that this functionality cannot be used after Close has been called. +// Reset can be called with a nil reader to release references to the previous reader. +// After being called with a nil reader, no other operations than Reset or DecodeAll or Close +// should be used. +func (d *Decoder) Reset(r io.Reader) error { + if d.current.err == ErrDecoderClosed { + return d.current.err + } + + d.drainOutput() + + d.syncStream.br.r = nil + if r == nil { + d.current.err = ErrDecoderNilInput + if len(d.current.b) > 0 { + d.current.b = d.current.b[:0] + } + d.current.flushed = true + return nil + } + + // If bytes buffer and < 5MB, do sync decoding anyway. + if bb, ok := r.(byter); ok && bb.Len() < d.o.decodeBufsBelow && !d.o.limitToCap { + bb2 := bb + if debugDecoder { + println("*bytes.Buffer detected, doing sync decode, len:", bb.Len()) + } + b := bb2.Bytes() + var dst []byte + if cap(d.syncStream.dstBuf) > 0 { + dst = d.syncStream.dstBuf[:0] + } + + dst, err := d.DecodeAll(b, dst) + if err == nil { + err = io.EOF + } + // Save output buffer + d.syncStream.dstBuf = dst + d.current.b = dst + d.current.err = err + d.current.flushed = true + if debugDecoder { + println("sync decode to", len(dst), "bytes, err:", err) + } + return nil + } + // Remove current block. + d.stashDecoder() + d.current.decodeOutput = decodeOutput{} + d.current.err = nil + d.current.flushed = false + d.current.d = nil + d.syncStream.dstBuf = nil + + // Ensure no-one else is still running... + d.streamWg.Wait() + if d.frame == nil { + d.frame = newFrameDec(d.o) + } + + if d.o.concurrent == 1 { + return d.startSyncDecoder(r) + } + + d.current.output = make(chan decodeOutput, d.o.concurrent) + ctx, cancel := context.WithCancel(context.Background()) + d.current.cancel = cancel + d.streamWg.Add(1) + go d.startStreamDecoder(ctx, r, d.current.output) + + return nil +} + +// drainOutput will drain the output until errEndOfStream is sent. +func (d *Decoder) drainOutput() { + if d.current.cancel != nil { + if debugDecoder { + println("cancelling current") + } + d.current.cancel() + d.current.cancel = nil + } + if d.current.d != nil { + if debugDecoder { + printf("re-adding current decoder %p, decoders: %d", d.current.d, len(d.decoders)) + } + d.decoders <- d.current.d + d.current.d = nil + d.current.b = nil + } + if d.current.output == nil || d.current.flushed { + println("current already flushed") + return + } + for v := range d.current.output { + if v.d != nil { + if debugDecoder { + printf("re-adding decoder %p", v.d) + } + d.decoders <- v.d + } + } + d.current.output = nil + d.current.flushed = true +} + +// WriteTo writes data to w until there's no more data to write or when an error occurs. +// The return value n is the number of bytes written. +// Any error encountered during the write is also returned. +func (d *Decoder) WriteTo(w io.Writer) (int64, error) { + var n int64 + for { + if len(d.current.b) > 0 { + n2, err2 := w.Write(d.current.b) + n += int64(n2) + if err2 != nil && (d.current.err == nil || d.current.err == io.EOF) { + d.current.err = err2 + } else if n2 != len(d.current.b) { + d.current.err = io.ErrShortWrite + } + } + if d.current.err != nil { + break + } + d.nextBlock(true) + } + err := d.current.err + if err != nil { + d.drainOutput() + } + if err == io.EOF { + err = nil + } + return n, err +} + +// DecodeAll allows stateless decoding of a blob of bytes. +// Output will be appended to dst, so if the destination size is known +// you can pre-allocate the destination slice to avoid allocations. +// DecodeAll can be used concurrently. +// The Decoder concurrency limits will be respected. +func (d *Decoder) DecodeAll(input, dst []byte) ([]byte, error) { + if d.decoders == nil { + return dst, ErrDecoderClosed + } + + // Grab a block decoder and frame decoder. + block := <-d.decoders + frame := block.localFrame + initialSize := len(dst) + defer func() { + if debugDecoder { + printf("re-adding decoder: %p", block) + } + frame.rawInput = nil + frame.bBuf = nil + if frame.history.decoders.br != nil { + frame.history.decoders.br.in = nil + } + d.decoders <- block + }() + frame.bBuf = input + + for { + frame.history.reset() + err := frame.reset(&frame.bBuf) + if err != nil { + if err == io.EOF { + if debugDecoder { + println("frame reset return EOF") + } + return dst, nil + } + return dst, err + } + if err = d.setDict(frame); err != nil { + return nil, err + } + if frame.WindowSize > d.o.maxWindowSize { + if debugDecoder { + println("window size exceeded:", frame.WindowSize, ">", d.o.maxWindowSize) + } + return dst, ErrWindowSizeExceeded + } + if frame.FrameContentSize != fcsUnknown { + if frame.FrameContentSize > d.o.maxDecodedSize-uint64(len(dst)-initialSize) { + if debugDecoder { + println("decoder size exceeded; fcs:", frame.FrameContentSize, "> mcs:", d.o.maxDecodedSize-uint64(len(dst)-initialSize), "len:", len(dst)) + } + return dst, ErrDecoderSizeExceeded + } + if d.o.limitToCap && frame.FrameContentSize > uint64(cap(dst)-len(dst)) { + if debugDecoder { + println("decoder size exceeded; fcs:", frame.FrameContentSize, "> (cap-len)", cap(dst)-len(dst)) + } + return dst, ErrDecoderSizeExceeded + } + if cap(dst)-len(dst) < int(frame.FrameContentSize) { + dst2 := make([]byte, len(dst), len(dst)+int(frame.FrameContentSize)+compressedBlockOverAlloc) + copy(dst2, dst) + dst = dst2 + } + } + + if cap(dst) == 0 && !d.o.limitToCap { + // Allocate len(input) * 2 by default if nothing is provided + // and we didn't get frame content size. + size := len(input) * 2 + // Cap to 1 MB. + if size > 1<<20 { + size = 1 << 20 + } + if uint64(size) > d.o.maxDecodedSize { + size = int(d.o.maxDecodedSize) + } + dst = make([]byte, 0, size) + } + + dst, err = frame.runDecoder(dst, block) + if err != nil { + return dst, err + } + if uint64(len(dst)-initialSize) > d.o.maxDecodedSize { + return dst, ErrDecoderSizeExceeded + } + if len(frame.bBuf) == 0 { + if debugDecoder { + println("frame dbuf empty") + } + break + } + } + return dst, nil +} + +// nextBlock returns the next block. +// If an error occurs d.err will be set. +// Optionally the function can block for new output. +// If non-blocking mode is used the returned boolean will be false +// if no data was available without blocking. +func (d *Decoder) nextBlock(blocking bool) (ok bool) { + if d.current.err != nil { + // Keep error state. + return false + } + d.current.b = d.current.b[:0] + + // SYNC: + if d.syncStream.enabled { + if !blocking { + return false + } + ok = d.nextBlockSync() + if !ok { + d.stashDecoder() + } + return ok + } + + //ASYNC: + d.stashDecoder() + if blocking { + d.current.decodeOutput, ok = <-d.current.output + } else { + select { + case d.current.decodeOutput, ok = <-d.current.output: + default: + return false + } + } + if !ok { + // This should not happen, so signal error state... + d.current.err = io.ErrUnexpectedEOF + return false + } + next := d.current.decodeOutput + if next.d != nil && next.d.async.newHist != nil { + d.current.crc.Reset() + } + if debugDecoder { + var tmp [4]byte + binary.LittleEndian.PutUint32(tmp[:], uint32(xxhash.Sum64(next.b))) + println("got", len(d.current.b), "bytes, error:", d.current.err, "data crc:", tmp) + } + + if d.o.ignoreChecksum { + return true + } + + if len(next.b) > 0 { + d.current.crc.Write(next.b) + } + if next.err == nil && next.d != nil && next.d.hasCRC { + got := uint32(d.current.crc.Sum64()) + if got != next.d.checkCRC { + if debugDecoder { + printf("CRC Check Failed: %08x (got) != %08x (on stream)\n", got, next.d.checkCRC) + } + d.current.err = ErrCRCMismatch + } else { + if debugDecoder { + printf("CRC ok %08x\n", got) + } + } + } + + return true +} + +func (d *Decoder) nextBlockSync() (ok bool) { + if d.current.d == nil { + d.current.d = <-d.decoders + } + for len(d.current.b) == 0 { + if !d.syncStream.inFrame { + d.frame.history.reset() + d.current.err = d.frame.reset(&d.syncStream.br) + if d.current.err == nil { + d.current.err = d.setDict(d.frame) + } + if d.current.err != nil { + return false + } + if d.frame.WindowSize > d.o.maxDecodedSize || d.frame.WindowSize > d.o.maxWindowSize { + d.current.err = ErrDecoderSizeExceeded + return false + } + + d.syncStream.decodedFrame = 0 + d.syncStream.inFrame = true + } + d.current.err = d.frame.next(d.current.d) + if d.current.err != nil { + return false + } + d.frame.history.ensureBlock() + if debugDecoder { + println("History trimmed:", len(d.frame.history.b), "decoded already:", d.syncStream.decodedFrame) + } + histBefore := len(d.frame.history.b) + d.current.err = d.current.d.decodeBuf(&d.frame.history) + + if d.current.err != nil { + println("error after:", d.current.err) + return false + } + d.current.b = d.frame.history.b[histBefore:] + if debugDecoder { + println("history after:", len(d.frame.history.b)) + } + + // Check frame size (before CRC) + d.syncStream.decodedFrame += uint64(len(d.current.b)) + if d.syncStream.decodedFrame > d.frame.FrameContentSize { + if debugDecoder { + printf("DecodedFrame (%d) > FrameContentSize (%d)\n", d.syncStream.decodedFrame, d.frame.FrameContentSize) + } + d.current.err = ErrFrameSizeExceeded + return false + } + + // Check FCS + if d.current.d.Last && d.frame.FrameContentSize != fcsUnknown && d.syncStream.decodedFrame != d.frame.FrameContentSize { + if debugDecoder { + printf("DecodedFrame (%d) != FrameContentSize (%d)\n", d.syncStream.decodedFrame, d.frame.FrameContentSize) + } + d.current.err = ErrFrameSizeMismatch + return false + } + + // Update/Check CRC + if d.frame.HasCheckSum { + if !d.o.ignoreChecksum { + d.frame.crc.Write(d.current.b) + } + if d.current.d.Last { + if !d.o.ignoreChecksum { + d.current.err = d.frame.checkCRC() + } else { + d.current.err = d.frame.consumeCRC() + } + if d.current.err != nil { + println("CRC error:", d.current.err) + return false + } + } + } + d.syncStream.inFrame = !d.current.d.Last + } + return true +} + +func (d *Decoder) stashDecoder() { + if d.current.d != nil { + if debugDecoder { + printf("re-adding current decoder %p", d.current.d) + } + d.decoders <- d.current.d + d.current.d = nil + } +} + +// Close will release all resources. +// It is NOT possible to reuse the decoder after this. +func (d *Decoder) Close() { + if d.current.err == ErrDecoderClosed { + return + } + d.drainOutput() + if d.current.cancel != nil { + d.current.cancel() + d.streamWg.Wait() + d.current.cancel = nil + } + if d.decoders != nil { + close(d.decoders) + for dec := range d.decoders { + dec.Close() + } + d.decoders = nil + } + if d.current.d != nil { + d.current.d.Close() + d.current.d = nil + } + d.current.err = ErrDecoderClosed +} + +// IOReadCloser returns the decoder as an io.ReadCloser for convenience. +// Any changes to the decoder will be reflected, so the returned ReadCloser +// can be reused along with the decoder. +// io.WriterTo is also supported by the returned ReadCloser. +func (d *Decoder) IOReadCloser() io.ReadCloser { + return closeWrapper{d: d} +} + +// closeWrapper wraps a function call as a closer. +type closeWrapper struct { + d *Decoder +} + +// WriteTo forwards WriteTo calls to the decoder. +func (c closeWrapper) WriteTo(w io.Writer) (n int64, err error) { + return c.d.WriteTo(w) +} + +// Read forwards read calls to the decoder. +func (c closeWrapper) Read(p []byte) (n int, err error) { + return c.d.Read(p) +} + +// Close closes the decoder. +func (c closeWrapper) Close() error { + c.d.Close() + return nil +} + +type decodeOutput struct { + d *blockDec + b []byte + err error +} + +func (d *Decoder) startSyncDecoder(r io.Reader) error { + d.frame.history.reset() + d.syncStream.br = readerWrapper{r: r} + d.syncStream.inFrame = false + d.syncStream.enabled = true + d.syncStream.decodedFrame = 0 + return nil +} + +// Create Decoder: +// ASYNC: +// Spawn 3 go routines. +// 0: Read frames and decode block literals. +// 1: Decode sequences. +// 2: Execute sequences, send to output. +func (d *Decoder) startStreamDecoder(ctx context.Context, r io.Reader, output chan decodeOutput) { + defer d.streamWg.Done() + br := readerWrapper{r: r} + + var seqDecode = make(chan *blockDec, d.o.concurrent) + var seqExecute = make(chan *blockDec, d.o.concurrent) + + // Async 1: Decode sequences... + go func() { + var hist history + var hasErr bool + + for block := range seqDecode { + if hasErr { + if block != nil { + seqExecute <- block + } + continue + } + if block.async.newHist != nil { + if debugDecoder { + println("Async 1: new history, recent:", block.async.newHist.recentOffsets) + } + hist.reset() + hist.decoders = block.async.newHist.decoders + hist.recentOffsets = block.async.newHist.recentOffsets + hist.windowSize = block.async.newHist.windowSize + if block.async.newHist.dict != nil { + hist.setDict(block.async.newHist.dict) + } + } + if block.err != nil || block.Type != blockTypeCompressed { + hasErr = block.err != nil + seqExecute <- block + continue + } + + hist.decoders.literals = block.async.literals + block.err = block.prepareSequences(block.async.seqData, &hist) + if debugDecoder && block.err != nil { + println("prepareSequences returned:", block.err) + } + hasErr = block.err != nil + if block.err == nil { + block.err = block.decodeSequences(&hist) + if debugDecoder && block.err != nil { + println("decodeSequences returned:", block.err) + } + hasErr = block.err != nil + // block.async.sequence = hist.decoders.seq[:hist.decoders.nSeqs] + block.async.seqSize = hist.decoders.seqSize + } + seqExecute <- block + } + close(seqExecute) + hist.reset() + }() + + var wg sync.WaitGroup + wg.Add(1) + + // Async 3: Execute sequences... + frameHistCache := d.frame.history.b + go func() { + var hist history + var decodedFrame uint64 + var fcs uint64 + var hasErr bool + for block := range seqExecute { + out := decodeOutput{err: block.err, d: block} + if block.err != nil || hasErr { + hasErr = true + output <- out + continue + } + if block.async.newHist != nil { + if debugDecoder { + println("Async 2: new history") + } + hist.reset() + hist.windowSize = block.async.newHist.windowSize + hist.allocFrameBuffer = block.async.newHist.allocFrameBuffer + if block.async.newHist.dict != nil { + hist.setDict(block.async.newHist.dict) + } + + if cap(hist.b) < hist.allocFrameBuffer { + if cap(frameHistCache) >= hist.allocFrameBuffer { + hist.b = frameHistCache + } else { + hist.b = make([]byte, 0, hist.allocFrameBuffer) + println("Alloc history sized", hist.allocFrameBuffer) + } + } + hist.b = hist.b[:0] + fcs = block.async.fcs + decodedFrame = 0 + } + do := decodeOutput{err: block.err, d: block} + switch block.Type { + case blockTypeRLE: + if debugDecoder { + println("add rle block length:", block.RLESize) + } + + if cap(block.dst) < int(block.RLESize) { + if block.lowMem { + block.dst = make([]byte, block.RLESize) + } else { + block.dst = make([]byte, maxCompressedBlockSize) + } + } + block.dst = block.dst[:block.RLESize] + v := block.data[0] + for i := range block.dst { + block.dst[i] = v + } + hist.append(block.dst) + do.b = block.dst + case blockTypeRaw: + if debugDecoder { + println("add raw block length:", len(block.data)) + } + hist.append(block.data) + do.b = block.data + case blockTypeCompressed: + if debugDecoder { + println("execute with history length:", len(hist.b), "window:", hist.windowSize) + } + hist.decoders.seqSize = block.async.seqSize + hist.decoders.literals = block.async.literals + do.err = block.executeSequences(&hist) + hasErr = do.err != nil + if debugDecoder && hasErr { + println("executeSequences returned:", do.err) + } + do.b = block.dst + } + if !hasErr { + decodedFrame += uint64(len(do.b)) + if decodedFrame > fcs { + println("fcs exceeded", block.Last, fcs, decodedFrame) + do.err = ErrFrameSizeExceeded + hasErr = true + } else if block.Last && fcs != fcsUnknown && decodedFrame != fcs { + do.err = ErrFrameSizeMismatch + hasErr = true + } else { + if debugDecoder { + println("fcs ok", block.Last, fcs, decodedFrame) + } + } + } + output <- do + } + close(output) + frameHistCache = hist.b + wg.Done() + if debugDecoder { + println("decoder goroutines finished") + } + hist.reset() + }() + + var hist history +decodeStream: + for { + var hasErr bool + hist.reset() + decodeBlock := func(block *blockDec) { + if hasErr { + if block != nil { + seqDecode <- block + } + return + } + if block.err != nil || block.Type != blockTypeCompressed { + hasErr = block.err != nil + seqDecode <- block + return + } + + remain, err := block.decodeLiterals(block.data, &hist) + block.err = err + hasErr = block.err != nil + if err == nil { + block.async.literals = hist.decoders.literals + block.async.seqData = remain + } else if debugDecoder { + println("decodeLiterals error:", err) + } + seqDecode <- block + } + frame := d.frame + if debugDecoder { + println("New frame...") + } + var historySent bool + frame.history.reset() + err := frame.reset(&br) + if debugDecoder && err != nil { + println("Frame decoder returned", err) + } + if err == nil { + err = d.setDict(frame) + } + if err == nil && d.frame.WindowSize > d.o.maxWindowSize { + if debugDecoder { + println("decoder size exceeded, fws:", d.frame.WindowSize, "> mws:", d.o.maxWindowSize) + } + + err = ErrDecoderSizeExceeded + } + if err != nil { + select { + case <-ctx.Done(): + case dec := <-d.decoders: + dec.sendErr(err) + decodeBlock(dec) + } + break decodeStream + } + + // Go through all blocks of the frame. + for { + var dec *blockDec + select { + case <-ctx.Done(): + break decodeStream + case dec = <-d.decoders: + // Once we have a decoder, we MUST return it. + } + err := frame.next(dec) + if !historySent { + h := frame.history + if debugDecoder { + println("Alloc History:", h.allocFrameBuffer) + } + hist.reset() + if h.dict != nil { + hist.setDict(h.dict) + } + dec.async.newHist = &h + dec.async.fcs = frame.FrameContentSize + historySent = true + } else { + dec.async.newHist = nil + } + if debugDecoder && err != nil { + println("next block returned error:", err) + } + dec.err = err + dec.hasCRC = false + if dec.Last && frame.HasCheckSum && err == nil { + crc, err := frame.rawInput.readSmall(4) + if len(crc) < 4 { + if err == nil { + err = io.ErrUnexpectedEOF + + } + println("CRC missing?", err) + dec.err = err + } else { + dec.checkCRC = binary.LittleEndian.Uint32(crc) + dec.hasCRC = true + if debugDecoder { + printf("found crc to check: %08x\n", dec.checkCRC) + } + } + } + err = dec.err + last := dec.Last + decodeBlock(dec) + if err != nil { + break decodeStream + } + if last { + break + } + } + } + close(seqDecode) + wg.Wait() + hist.reset() + d.frame.history.b = frameHistCache +} + +func (d *Decoder) setDict(frame *frameDec) (err error) { + dict, ok := d.dicts[frame.DictionaryID] + if ok { + if debugDecoder { + println("setting dict", frame.DictionaryID) + } + frame.history.setDict(dict) + } else if frame.DictionaryID != 0 { + // A zero or missing dictionary id is ambiguous: + // either dictionary zero, or no dictionary. In particular, + // zstd --patch-from uses this id for the source file, + // so only return an error if the dictionary id is not zero. + err = ErrUnknownDictionary + } + return err +} diff --git a/vendor/github.com/klauspost/compress/zstd/decoder_options.go b/vendor/github.com/klauspost/compress/zstd/decoder_options.go new file mode 100644 index 000000000..774c5f00f --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/decoder_options.go @@ -0,0 +1,169 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "errors" + "fmt" + "math/bits" + "runtime" +) + +// DOption is an option for creating a decoder. +type DOption func(*decoderOptions) error + +// options retains accumulated state of multiple options. +type decoderOptions struct { + lowMem bool + concurrent int + maxDecodedSize uint64 + maxWindowSize uint64 + dicts []*dict + ignoreChecksum bool + limitToCap bool + decodeBufsBelow int +} + +func (o *decoderOptions) setDefault() { + *o = decoderOptions{ + // use less ram: true for now, but may change. + lowMem: true, + concurrent: runtime.GOMAXPROCS(0), + maxWindowSize: MaxWindowSize, + decodeBufsBelow: 128 << 10, + } + if o.concurrent > 4 { + o.concurrent = 4 + } + o.maxDecodedSize = 64 << 30 +} + +// WithDecoderLowmem will set whether to use a lower amount of memory, +// but possibly have to allocate more while running. +func WithDecoderLowmem(b bool) DOption { + return func(o *decoderOptions) error { o.lowMem = b; return nil } +} + +// WithDecoderConcurrency sets the number of created decoders. +// When decoding block with DecodeAll, this will limit the number +// of possible concurrently running decodes. +// When decoding streams, this will limit the number of +// inflight blocks. +// When decoding streams and setting maximum to 1, +// no async decoding will be done. +// When a value of 0 is provided GOMAXPROCS will be used. +// By default this will be set to 4 or GOMAXPROCS, whatever is lower. +func WithDecoderConcurrency(n int) DOption { + return func(o *decoderOptions) error { + if n < 0 { + return errors.New("concurrency must be at least 1") + } + if n == 0 { + o.concurrent = runtime.GOMAXPROCS(0) + } else { + o.concurrent = n + } + return nil + } +} + +// WithDecoderMaxMemory allows to set a maximum decoded size for in-memory +// non-streaming operations or maximum window size for streaming operations. +// This can be used to control memory usage of potentially hostile content. +// Maximum is 1 << 63 bytes. Default is 64GiB. +func WithDecoderMaxMemory(n uint64) DOption { + return func(o *decoderOptions) error { + if n == 0 { + return errors.New("WithDecoderMaxMemory must be at least 1") + } + if n > 1<<63 { + return errors.New("WithDecoderMaxmemory must be less than 1 << 63") + } + o.maxDecodedSize = n + return nil + } +} + +// WithDecoderDicts allows to register one or more dictionaries for the decoder. +// +// Each slice in dict must be in the [dictionary format] produced by +// "zstd --train" from the Zstandard reference implementation. +// +// If several dictionaries with the same ID are provided, the last one will be used. +// +// [dictionary format]: https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#dictionary-format +func WithDecoderDicts(dicts ...[]byte) DOption { + return func(o *decoderOptions) error { + for _, b := range dicts { + d, err := loadDict(b) + if err != nil { + return err + } + o.dicts = append(o.dicts, d) + } + return nil + } +} + +// WithDecoderDictRaw registers a dictionary that may be used by the decoder. +// The slice content can be arbitrary data. +func WithDecoderDictRaw(id uint32, content []byte) DOption { + return func(o *decoderOptions) error { + if bits.UintSize > 32 && uint(len(content)) > dictMaxLength { + return fmt.Errorf("dictionary of size %d > 2GiB too large", len(content)) + } + o.dicts = append(o.dicts, &dict{id: id, content: content, offsets: [3]int{1, 4, 8}}) + return nil + } +} + +// WithDecoderMaxWindow allows to set a maximum window size for decodes. +// This allows rejecting packets that will cause big memory usage. +// The Decoder will likely allocate more memory based on the WithDecoderLowmem setting. +// If WithDecoderMaxMemory is set to a lower value, that will be used. +// Default is 512MB, Maximum is ~3.75 TB as per zstandard spec. +func WithDecoderMaxWindow(size uint64) DOption { + return func(o *decoderOptions) error { + if size < MinWindowSize { + return errors.New("WithMaxWindowSize must be at least 1KB, 1024 bytes") + } + if size > (1<<41)+7*(1<<38) { + return errors.New("WithMaxWindowSize must be less than (1<<41) + 7*(1<<38) ~ 3.75TB") + } + o.maxWindowSize = size + return nil + } +} + +// WithDecodeAllCapLimit will limit DecodeAll to decoding cap(dst)-len(dst) bytes, +// or any size set in WithDecoderMaxMemory. +// This can be used to limit decoding to a specific maximum output size. +// Disabled by default. +func WithDecodeAllCapLimit(b bool) DOption { + return func(o *decoderOptions) error { + o.limitToCap = b + return nil + } +} + +// WithDecodeBuffersBelow will fully decode readers that have a +// `Bytes() []byte` and `Len() int` interface similar to bytes.Buffer. +// This typically uses less allocations but will have the full decompressed object in memory. +// Note that DecodeAllCapLimit will disable this, as well as giving a size of 0 or less. +// Default is 128KiB. +func WithDecodeBuffersBelow(size int) DOption { + return func(o *decoderOptions) error { + o.decodeBufsBelow = size + return nil + } +} + +// IgnoreChecksum allows to forcibly ignore checksum checking. +func IgnoreChecksum(b bool) DOption { + return func(o *decoderOptions) error { + o.ignoreChecksum = b + return nil + } +} diff --git a/vendor/github.com/klauspost/compress/zstd/dict.go b/vendor/github.com/klauspost/compress/zstd/dict.go new file mode 100644 index 000000000..ca0951452 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/dict.go @@ -0,0 +1,161 @@ +package zstd + +import ( + "encoding/binary" + "errors" + "fmt" + "io" + + "github.com/klauspost/compress/huff0" +) + +type dict struct { + id uint32 + + litEnc *huff0.Scratch + llDec, ofDec, mlDec sequenceDec + //llEnc, ofEnc, mlEnc []*fseEncoder + offsets [3]int + content []byte +} + +const dictMagic = "\x37\xa4\x30\xec" + +// Maximum dictionary size for the reference implementation (1.5.3) is 2 GiB. +const dictMaxLength = 1 << 31 + +// ID returns the dictionary id or 0 if d is nil. +func (d *dict) ID() uint32 { + if d == nil { + return 0 + } + return d.id +} + +// ContentSize returns the dictionary content size or 0 if d is nil. +func (d *dict) ContentSize() int { + if d == nil { + return 0 + } + return len(d.content) +} + +// Content returns the dictionary content. +func (d *dict) Content() []byte { + if d == nil { + return nil + } + return d.content +} + +// Offsets returns the initial offsets. +func (d *dict) Offsets() [3]int { + if d == nil { + return [3]int{} + } + return d.offsets +} + +// LitEncoder returns the literal encoder. +func (d *dict) LitEncoder() *huff0.Scratch { + if d == nil { + return nil + } + return d.litEnc +} + +// Load a dictionary as described in +// https://github.com/facebook/zstd/blob/master/doc/zstd_compression_format.md#dictionary-format +func loadDict(b []byte) (*dict, error) { + // Check static field size. + if len(b) <= 8+(3*4) { + return nil, io.ErrUnexpectedEOF + } + d := dict{ + llDec: sequenceDec{fse: &fseDecoder{}}, + ofDec: sequenceDec{fse: &fseDecoder{}}, + mlDec: sequenceDec{fse: &fseDecoder{}}, + } + if string(b[:4]) != dictMagic { + return nil, ErrMagicMismatch + } + d.id = binary.LittleEndian.Uint32(b[4:8]) + if d.id == 0 { + return nil, errors.New("dictionaries cannot have ID 0") + } + + // Read literal table + var err error + d.litEnc, b, err = huff0.ReadTable(b[8:], nil) + if err != nil { + return nil, fmt.Errorf("loading literal table: %w", err) + } + d.litEnc.Reuse = huff0.ReusePolicyMust + + br := byteReader{ + b: b, + off: 0, + } + readDec := func(i tableIndex, dec *fseDecoder) error { + if err := dec.readNCount(&br, uint16(maxTableSymbol[i])); err != nil { + return err + } + if br.overread() { + return io.ErrUnexpectedEOF + } + err = dec.transform(symbolTableX[i]) + if err != nil { + println("Transform table error:", err) + return err + } + if debugDecoder || debugEncoder { + println("Read table ok", "symbolLen:", dec.symbolLen) + } + // Set decoders as predefined so they aren't reused. + dec.preDefined = true + return nil + } + + if err := readDec(tableOffsets, d.ofDec.fse); err != nil { + return nil, err + } + if err := readDec(tableMatchLengths, d.mlDec.fse); err != nil { + return nil, err + } + if err := readDec(tableLiteralLengths, d.llDec.fse); err != nil { + return nil, err + } + if br.remain() < 12 { + return nil, io.ErrUnexpectedEOF + } + + d.offsets[0] = int(br.Uint32()) + br.advance(4) + d.offsets[1] = int(br.Uint32()) + br.advance(4) + d.offsets[2] = int(br.Uint32()) + br.advance(4) + if d.offsets[0] <= 0 || d.offsets[1] <= 0 || d.offsets[2] <= 0 { + return nil, errors.New("invalid offset in dictionary") + } + d.content = make([]byte, br.remain()) + copy(d.content, br.unread()) + if d.offsets[0] > len(d.content) || d.offsets[1] > len(d.content) || d.offsets[2] > len(d.content) { + return nil, fmt.Errorf("initial offset bigger than dictionary content size %d, offsets: %v", len(d.content), d.offsets) + } + + return &d, nil +} + +// InspectDictionary loads a zstd dictionary and provides functions to inspect the content. +func InspectDictionary(b []byte) (interface { + ID() uint32 + ContentSize() int + Content() []byte + Offsets() [3]int + LitEncoder() *huff0.Scratch +}, error) { + initPredefined() + d, err := loadDict(b) + return d, err +} diff --git a/vendor/github.com/klauspost/compress/zstd/enc_base.go b/vendor/github.com/klauspost/compress/zstd/enc_base.go new file mode 100644 index 000000000..5ca46038a --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/enc_base.go @@ -0,0 +1,173 @@ +package zstd + +import ( + "fmt" + "math/bits" + + "github.com/klauspost/compress/zstd/internal/xxhash" +) + +const ( + dictShardBits = 6 +) + +type fastBase struct { + // cur is the offset at the start of hist + cur int32 + // maximum offset. Should be at least 2x block size. + maxMatchOff int32 + bufferReset int32 + hist []byte + crc *xxhash.Digest + tmp [8]byte + blk *blockEnc + lastDictID uint32 + lowMem bool +} + +// CRC returns the underlying CRC writer. +func (e *fastBase) CRC() *xxhash.Digest { + return e.crc +} + +// AppendCRC will append the CRC to the destination slice and return it. +func (e *fastBase) AppendCRC(dst []byte) []byte { + crc := e.crc.Sum(e.tmp[:0]) + dst = append(dst, crc[7], crc[6], crc[5], crc[4]) + return dst +} + +// WindowSize returns the window size of the encoder, +// or a window size small enough to contain the input size, if > 0. +func (e *fastBase) WindowSize(size int64) int32 { + if size > 0 && size < int64(e.maxMatchOff) { + b := int32(1) << uint(bits.Len(uint(size))) + // Keep minimum window. + if b < 1024 { + b = 1024 + } + return b + } + return e.maxMatchOff +} + +// Block returns the current block. +func (e *fastBase) Block() *blockEnc { + return e.blk +} + +func (e *fastBase) addBlock(src []byte) int32 { + if debugAsserts && e.cur > e.bufferReset { + panic(fmt.Sprintf("ecur (%d) > buffer reset (%d)", e.cur, e.bufferReset)) + } + // check if we have space already + if len(e.hist)+len(src) > cap(e.hist) { + if cap(e.hist) == 0 { + e.ensureHist(len(src)) + } else { + if cap(e.hist) < int(e.maxMatchOff+maxCompressedBlockSize) { + panic(fmt.Errorf("unexpected buffer cap %d, want at least %d with window %d", cap(e.hist), e.maxMatchOff+maxCompressedBlockSize, e.maxMatchOff)) + } + // Move down + offset := int32(len(e.hist)) - e.maxMatchOff + copy(e.hist[0:e.maxMatchOff], e.hist[offset:]) + e.cur += offset + e.hist = e.hist[:e.maxMatchOff] + } + } + s := int32(len(e.hist)) + e.hist = append(e.hist, src...) + return s +} + +// ensureHist will ensure that history can keep at least this many bytes. +func (e *fastBase) ensureHist(n int) { + if cap(e.hist) >= n { + return + } + l := e.maxMatchOff + if (e.lowMem && e.maxMatchOff > maxCompressedBlockSize) || e.maxMatchOff <= maxCompressedBlockSize { + l += maxCompressedBlockSize + } else { + l += e.maxMatchOff + } + // Make it at least 1MB. + if l < 1<<20 && !e.lowMem { + l = 1 << 20 + } + // Make it at least the requested size. + if l < int32(n) { + l = int32(n) + } + e.hist = make([]byte, 0, l) +} + +// useBlock will replace the block with the provided one, +// but transfer recent offsets from the previous. +func (e *fastBase) UseBlock(enc *blockEnc) { + enc.reset(e.blk) + e.blk = enc +} + +func (e *fastBase) matchlen(s, t int32, src []byte) int32 { + if debugAsserts { + if s < 0 { + err := fmt.Sprintf("s (%d) < 0", s) + panic(err) + } + if t < 0 { + err := fmt.Sprintf("s (%d) < 0", s) + panic(err) + } + if s-t > e.maxMatchOff { + err := fmt.Sprintf("s (%d) - t (%d) > maxMatchOff (%d)", s, t, e.maxMatchOff) + panic(err) + } + if len(src)-int(s) > maxCompressedBlockSize { + panic(fmt.Sprintf("len(src)-s (%d) > maxCompressedBlockSize (%d)", len(src)-int(s), maxCompressedBlockSize)) + } + } + return int32(matchLen(src[s:], src[t:])) +} + +// Reset the encoding table. +func (e *fastBase) resetBase(d *dict, singleBlock bool) { + if e.blk == nil { + e.blk = &blockEnc{lowMem: e.lowMem} + e.blk.init() + } else { + e.blk.reset(nil) + } + e.blk.initNewEncode() + if e.crc == nil { + e.crc = xxhash.New() + } else { + e.crc.Reset() + } + e.blk.dictLitEnc = nil + if d != nil { + low := e.lowMem + if singleBlock { + e.lowMem = true + } + e.ensureHist(d.ContentSize() + maxCompressedBlockSize) + e.lowMem = low + } + + // We offset current position so everything will be out of reach. + // If above reset line, history will be purged. + if e.cur < e.bufferReset { + e.cur += e.maxMatchOff + int32(len(e.hist)) + } + e.hist = e.hist[:0] + if d != nil { + // Set offsets (currently not used) + for i, off := range d.offsets { + e.blk.recentOffsets[i] = uint32(off) + e.blk.prevRecentOffsets[i] = e.blk.recentOffsets[i] + } + // Transfer litenc. + e.blk.dictLitEnc = d.litEnc + e.hist = append(e.hist, d.content...) + } +} diff --git a/vendor/github.com/klauspost/compress/zstd/enc_best.go b/vendor/github.com/klauspost/compress/zstd/enc_best.go new file mode 100644 index 000000000..9819d4145 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/enc_best.go @@ -0,0 +1,530 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "bytes" + "fmt" + + "github.com/klauspost/compress" +) + +const ( + bestLongTableBits = 22 // Bits used in the long match table + bestLongTableSize = 1 << bestLongTableBits // Size of the table + bestLongLen = 8 // Bytes used for table hash + + // Note: Increasing the short table bits or making the hash shorter + // can actually lead to compression degradation since it will 'steal' more from the + // long match table and match offsets are quite big. + // This greatly depends on the type of input. + bestShortTableBits = 18 // Bits used in the short match table + bestShortTableSize = 1 << bestShortTableBits // Size of the table + bestShortLen = 4 // Bytes used for table hash + +) + +type match struct { + offset int32 + s int32 + length int32 + rep int32 + est int32 +} + +const highScore = maxMatchLen * 8 + +// estBits will estimate output bits from predefined tables. +func (m *match) estBits(bitsPerByte int32) { + mlc := mlCode(uint32(m.length - zstdMinMatch)) + var ofc uint8 + if m.rep < 0 { + ofc = ofCode(uint32(m.s-m.offset) + 3) + } else { + ofc = ofCode(uint32(m.rep)) + } + // Cost, excluding + ofTT, mlTT := fsePredefEnc[tableOffsets].ct.symbolTT[ofc], fsePredefEnc[tableMatchLengths].ct.symbolTT[mlc] + + // Add cost of match encoding... + m.est = int32(ofTT.outBits + mlTT.outBits) + m.est += int32(ofTT.deltaNbBits>>16 + mlTT.deltaNbBits>>16) + // Subtract savings compared to literal encoding... + m.est -= (m.length * bitsPerByte) >> 10 + if m.est > 0 { + // Unlikely gain.. + m.length = 0 + m.est = highScore + } +} + +// bestFastEncoder uses 2 tables, one for short matches (5 bytes) and one for long matches. +// The long match table contains the previous entry with the same hash, +// effectively making it a "chain" of length 2. +// When we find a long match we choose between the two values and select the longest. +// When we find a short match, after checking the long, we check if we can find a long at n+1 +// and that it is longer (lazy matching). +type bestFastEncoder struct { + fastBase + table [bestShortTableSize]prevEntry + longTable [bestLongTableSize]prevEntry + dictTable []prevEntry + dictLongTable []prevEntry +} + +// Encode improves compression... +func (e *bestFastEncoder) Encode(blk *blockEnc, src []byte) { + const ( + // Input margin is the number of bytes we read (8) + // and the maximum we will read ahead (2) + inputMargin = 8 + 4 + minNonLiteralBlockSize = 16 + ) + + // Protect against e.cur wraparound. + for e.cur >= e.bufferReset-int32(len(e.hist)) { + if len(e.hist) == 0 { + e.table = [bestShortTableSize]prevEntry{} + e.longTable = [bestLongTableSize]prevEntry{} + e.cur = e.maxMatchOff + break + } + // Shift down everything in the table that isn't already too far away. + minOff := e.cur + int32(len(e.hist)) - e.maxMatchOff + for i := range e.table[:] { + v := e.table[i].offset + v2 := e.table[i].prev + if v < minOff { + v = 0 + v2 = 0 + } else { + v = v - e.cur + e.maxMatchOff + if v2 < minOff { + v2 = 0 + } else { + v2 = v2 - e.cur + e.maxMatchOff + } + } + e.table[i] = prevEntry{ + offset: v, + prev: v2, + } + } + for i := range e.longTable[:] { + v := e.longTable[i].offset + v2 := e.longTable[i].prev + if v < minOff { + v = 0 + v2 = 0 + } else { + v = v - e.cur + e.maxMatchOff + if v2 < minOff { + v2 = 0 + } else { + v2 = v2 - e.cur + e.maxMatchOff + } + } + e.longTable[i] = prevEntry{ + offset: v, + prev: v2, + } + } + e.cur = e.maxMatchOff + break + } + + s := e.addBlock(src) + blk.size = len(src) + if len(src) < minNonLiteralBlockSize { + blk.extraLits = len(src) + blk.literals = blk.literals[:len(src)] + copy(blk.literals, src) + return + } + + // Use this to estimate literal cost. + // Scaled by 10 bits. + bitsPerByte := int32((compress.ShannonEntropyBits(src) * 1024) / len(src)) + // Huffman can never go < 1 bit/byte + if bitsPerByte < 1024 { + bitsPerByte = 1024 + } + + // Override src + src = e.hist + sLimit := int32(len(src)) - inputMargin + const kSearchStrength = 10 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := s + + // Relative offsets + offset1 := int32(blk.recentOffsets[0]) + offset2 := int32(blk.recentOffsets[1]) + offset3 := int32(blk.recentOffsets[2]) + + addLiterals := func(s *seq, until int32) { + if until == nextEmit { + return + } + blk.literals = append(blk.literals, src[nextEmit:until]...) + s.litLen = uint32(until - nextEmit) + } + + if debugEncoder { + println("recent offsets:", blk.recentOffsets) + } + +encodeLoop: + for { + // We allow the encoder to optionally turn off repeat offsets across blocks + canRepeat := len(blk.sequences) > 2 + + if debugAsserts && canRepeat && offset1 == 0 { + panic("offset0 was 0") + } + + const goodEnough = 250 + + cv := load6432(src, s) + + nextHashL := hashLen(cv, bestLongTableBits, bestLongLen) + nextHashS := hashLen(cv, bestShortTableBits, bestShortLen) + candidateL := e.longTable[nextHashL] + candidateS := e.table[nextHashS] + + // Set m to a match at offset if it looks like that will improve compression. + improve := func(m *match, offset int32, s int32, first uint32, rep int32) { + if s-offset >= e.maxMatchOff || load3232(src, offset) != first { + return + } + if debugAsserts { + if offset <= 0 { + panic(offset) + } + if !bytes.Equal(src[s:s+4], src[offset:offset+4]) { + panic(fmt.Sprintf("first match mismatch: %v != %v, first: %08x", src[s:s+4], src[offset:offset+4], first)) + } + } + // Try to quick reject if we already have a long match. + if m.length > 16 { + left := len(src) - int(m.s+m.length) + // If we are too close to the end, keep as is. + if left <= 0 { + return + } + checkLen := m.length - (s - m.s) - 8 + if left > 2 && checkLen > 4 { + // Check 4 bytes, 4 bytes from the end of the current match. + a := load3232(src, offset+checkLen) + b := load3232(src, s+checkLen) + if a != b { + return + } + } + } + l := 4 + e.matchlen(s+4, offset+4, src) + if rep < 0 { + // Extend candidate match backwards as far as possible. + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for offset > tMin && s > nextEmit && src[offset-1] == src[s-1] && l < maxMatchLength { + s-- + offset-- + l++ + } + } + + cand := match{offset: offset, s: s, length: l, rep: rep} + cand.estBits(bitsPerByte) + if m.est >= highScore || cand.est-m.est+(cand.s-m.s)*bitsPerByte>>10 < 0 { + *m = cand + } + } + + best := match{s: s, est: highScore} + improve(&best, candidateL.offset-e.cur, s, uint32(cv), -1) + improve(&best, candidateL.prev-e.cur, s, uint32(cv), -1) + improve(&best, candidateS.offset-e.cur, s, uint32(cv), -1) + improve(&best, candidateS.prev-e.cur, s, uint32(cv), -1) + + if canRepeat && best.length < goodEnough { + if s == nextEmit { + // Check repeats straight after a match. + improve(&best, s-offset2, s, uint32(cv), 1|4) + improve(&best, s-offset3, s, uint32(cv), 2|4) + if offset1 > 1 { + improve(&best, s-(offset1-1), s, uint32(cv), 3|4) + } + } + + // If either no match or a non-repeat match, check at + 1 + if best.rep <= 0 { + cv32 := uint32(cv >> 8) + spp := s + 1 + improve(&best, spp-offset1, spp, cv32, 1) + improve(&best, spp-offset2, spp, cv32, 2) + improve(&best, spp-offset3, spp, cv32, 3) + if best.rep < 0 { + cv32 = uint32(cv >> 24) + spp += 2 + improve(&best, spp-offset1, spp, cv32, 1) + improve(&best, spp-offset2, spp, cv32, 2) + improve(&best, spp-offset3, spp, cv32, 3) + } + } + } + // Load next and check... + e.longTable[nextHashL] = prevEntry{offset: s + e.cur, prev: candidateL.offset} + e.table[nextHashS] = prevEntry{offset: s + e.cur, prev: candidateS.offset} + + // Look far ahead, unless we have a really long match already... + if best.length < goodEnough { + // No match found, move forward on input, no need to check forward... + if best.length < 4 { + s += 1 + (s-nextEmit)>>(kSearchStrength-1) + if s >= sLimit { + break encodeLoop + } + continue + } + + candidateS = e.table[hashLen(cv>>8, bestShortTableBits, bestShortLen)] + cv = load6432(src, s+1) + cv2 := load6432(src, s+2) + candidateL = e.longTable[hashLen(cv, bestLongTableBits, bestLongLen)] + candidateL2 := e.longTable[hashLen(cv2, bestLongTableBits, bestLongLen)] + + // Short at s+1 + improve(&best, candidateS.offset-e.cur, s+1, uint32(cv), -1) + // Long at s+1, s+2 + improve(&best, candidateL.offset-e.cur, s+1, uint32(cv), -1) + improve(&best, candidateL.prev-e.cur, s+1, uint32(cv), -1) + improve(&best, candidateL2.offset-e.cur, s+2, uint32(cv2), -1) + improve(&best, candidateL2.prev-e.cur, s+2, uint32(cv2), -1) + if false { + // Short at s+3. + // Too often worse... + improve(&best, e.table[hashLen(cv2>>8, bestShortTableBits, bestShortLen)].offset-e.cur, s+3, uint32(cv2>>8), -1) + } + + // Start check at a fixed offset to allow for a few mismatches. + // For this compression level 2 yields the best results. + // We cannot do this if we have already indexed this position. + const skipBeginning = 2 + if best.s > s-skipBeginning { + // See if we can find a better match by checking where the current best ends. + // Use that offset to see if we can find a better full match. + if sAt := best.s + best.length; sAt < sLimit { + nextHashL := hashLen(load6432(src, sAt), bestLongTableBits, bestLongLen) + candidateEnd := e.longTable[nextHashL] + + if off := candidateEnd.offset - e.cur - best.length + skipBeginning; off >= 0 { + improve(&best, off, best.s+skipBeginning, load3232(src, best.s+skipBeginning), -1) + if off := candidateEnd.prev - e.cur - best.length + skipBeginning; off >= 0 { + improve(&best, off, best.s+skipBeginning, load3232(src, best.s+skipBeginning), -1) + } + } + } + } + } + + if debugAsserts { + if !bytes.Equal(src[best.s:best.s+best.length], src[best.offset:best.offset+best.length]) { + panic(fmt.Sprintf("match mismatch: %v != %v", src[best.s:best.s+best.length], src[best.offset:best.offset+best.length])) + } + } + + // We have a match, we can store the forward value + if best.rep > 0 { + var seq seq + seq.matchLen = uint32(best.length - zstdMinMatch) + if debugAsserts && s <= nextEmit { + panic("s <= nextEmit") + } + addLiterals(&seq, best.s) + + // Repeat. If bit 4 is set, this is a non-lit repeat. + seq.offset = uint32(best.rep & 3) + if debugSequences { + println("repeat sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + + // Index old s + 1 -> s - 1 + index0 := s + 1 + s = best.s + best.length + + nextEmit = s + if s >= sLimit { + if debugEncoder { + println("repeat ended", s, best.length) + } + break encodeLoop + } + // Index skipped... + off := index0 + e.cur + for index0 < s { + cv0 := load6432(src, index0) + h0 := hashLen(cv0, bestLongTableBits, bestLongLen) + h1 := hashLen(cv0, bestShortTableBits, bestShortLen) + e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} + e.table[h1] = prevEntry{offset: off, prev: e.table[h1].offset} + off++ + index0++ + } + switch best.rep { + case 2, 4 | 1: + offset1, offset2 = offset2, offset1 + case 3, 4 | 2: + offset1, offset2, offset3 = offset3, offset1, offset2 + case 4 | 3: + offset1, offset2, offset3 = offset1-1, offset1, offset2 + } + continue + } + + // A 4-byte match has been found. Update recent offsets. + // We'll later see if more than 4 bytes. + index0 := s + 1 + s = best.s + t := best.offset + offset1, offset2, offset3 = s-t, offset1, offset2 + + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + + if debugAsserts && int(offset1) > len(src) { + panic("invalid offset") + } + + // Write our sequence + var seq seq + l := best.length + seq.litLen = uint32(s - nextEmit) + seq.matchLen = uint32(l - zstdMinMatch) + if seq.litLen > 0 { + blk.literals = append(blk.literals, src[nextEmit:s]...) + } + seq.offset = uint32(s-t) + 3 + s += l + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + nextEmit = s + if s >= sLimit { + break encodeLoop + } + + // Index old s + 1 -> s - 1 + for index0 < s { + cv0 := load6432(src, index0) + h0 := hashLen(cv0, bestLongTableBits, bestLongLen) + h1 := hashLen(cv0, bestShortTableBits, bestShortLen) + off := index0 + e.cur + e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} + e.table[h1] = prevEntry{offset: off, prev: e.table[h1].offset} + index0++ + } + } + + if int(nextEmit) < len(src) { + blk.literals = append(blk.literals, src[nextEmit:]...) + blk.extraLits = len(src) - int(nextEmit) + } + blk.recentOffsets[0] = uint32(offset1) + blk.recentOffsets[1] = uint32(offset2) + blk.recentOffsets[2] = uint32(offset3) + if debugEncoder { + println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) + } +} + +// EncodeNoHist will encode a block with no history and no following blocks. +// Most notable difference is that src will not be copied for history and +// we do not need to check for max match length. +func (e *bestFastEncoder) EncodeNoHist(blk *blockEnc, src []byte) { + e.ensureHist(len(src)) + e.Encode(blk, src) +} + +// Reset will reset and set a dictionary if not nil +func (e *bestFastEncoder) Reset(d *dict, singleBlock bool) { + e.resetBase(d, singleBlock) + if d == nil { + return + } + // Init or copy dict table + if len(e.dictTable) != len(e.table) || d.id != e.lastDictID { + if len(e.dictTable) != len(e.table) { + e.dictTable = make([]prevEntry, len(e.table)) + } + end := int32(len(d.content)) - 8 + e.maxMatchOff + for i := e.maxMatchOff; i < end; i += 4 { + const hashLog = bestShortTableBits + + cv := load6432(d.content, i-e.maxMatchOff) + nextHash := hashLen(cv, hashLog, bestShortLen) // 0 -> 4 + nextHash1 := hashLen(cv>>8, hashLog, bestShortLen) // 1 -> 5 + nextHash2 := hashLen(cv>>16, hashLog, bestShortLen) // 2 -> 6 + nextHash3 := hashLen(cv>>24, hashLog, bestShortLen) // 3 -> 7 + e.dictTable[nextHash] = prevEntry{ + prev: e.dictTable[nextHash].offset, + offset: i, + } + e.dictTable[nextHash1] = prevEntry{ + prev: e.dictTable[nextHash1].offset, + offset: i + 1, + } + e.dictTable[nextHash2] = prevEntry{ + prev: e.dictTable[nextHash2].offset, + offset: i + 2, + } + e.dictTable[nextHash3] = prevEntry{ + prev: e.dictTable[nextHash3].offset, + offset: i + 3, + } + } + e.lastDictID = d.id + } + + // Init or copy dict table + if len(e.dictLongTable) != len(e.longTable) || d.id != e.lastDictID { + if len(e.dictLongTable) != len(e.longTable) { + e.dictLongTable = make([]prevEntry, len(e.longTable)) + } + if len(d.content) >= 8 { + cv := load6432(d.content, 0) + h := hashLen(cv, bestLongTableBits, bestLongLen) + e.dictLongTable[h] = prevEntry{ + offset: e.maxMatchOff, + prev: e.dictLongTable[h].offset, + } + + end := int32(len(d.content)) - 8 + e.maxMatchOff + off := 8 // First to read + for i := e.maxMatchOff + 1; i < end; i++ { + cv = cv>>8 | (uint64(d.content[off]) << 56) + h := hashLen(cv, bestLongTableBits, bestLongLen) + e.dictLongTable[h] = prevEntry{ + offset: i, + prev: e.dictLongTable[h].offset, + } + off++ + } + } + e.lastDictID = d.id + } + // Reset table to initial state + copy(e.longTable[:], e.dictLongTable) + + e.cur = e.maxMatchOff + // Reset table to initial state + copy(e.table[:], e.dictTable) +} diff --git a/vendor/github.com/klauspost/compress/zstd/enc_better.go b/vendor/github.com/klauspost/compress/zstd/enc_better.go new file mode 100644 index 000000000..8582f31a7 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/enc_better.go @@ -0,0 +1,1242 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import "fmt" + +const ( + betterLongTableBits = 19 // Bits used in the long match table + betterLongTableSize = 1 << betterLongTableBits // Size of the table + betterLongLen = 8 // Bytes used for table hash + + // Note: Increasing the short table bits or making the hash shorter + // can actually lead to compression degradation since it will 'steal' more from the + // long match table and match offsets are quite big. + // This greatly depends on the type of input. + betterShortTableBits = 13 // Bits used in the short match table + betterShortTableSize = 1 << betterShortTableBits // Size of the table + betterShortLen = 5 // Bytes used for table hash + + betterLongTableShardCnt = 1 << (betterLongTableBits - dictShardBits) // Number of shards in the table + betterLongTableShardSize = betterLongTableSize / betterLongTableShardCnt // Size of an individual shard + + betterShortTableShardCnt = 1 << (betterShortTableBits - dictShardBits) // Number of shards in the table + betterShortTableShardSize = betterShortTableSize / betterShortTableShardCnt // Size of an individual shard +) + +type prevEntry struct { + offset int32 + prev int32 +} + +// betterFastEncoder uses 2 tables, one for short matches (5 bytes) and one for long matches. +// The long match table contains the previous entry with the same hash, +// effectively making it a "chain" of length 2. +// When we find a long match we choose between the two values and select the longest. +// When we find a short match, after checking the long, we check if we can find a long at n+1 +// and that it is longer (lazy matching). +type betterFastEncoder struct { + fastBase + table [betterShortTableSize]tableEntry + longTable [betterLongTableSize]prevEntry +} + +type betterFastEncoderDict struct { + betterFastEncoder + dictTable []tableEntry + dictLongTable []prevEntry + shortTableShardDirty [betterShortTableShardCnt]bool + longTableShardDirty [betterLongTableShardCnt]bool + allDirty bool +} + +// Encode improves compression... +func (e *betterFastEncoder) Encode(blk *blockEnc, src []byte) { + const ( + // Input margin is the number of bytes we read (8) + // and the maximum we will read ahead (2) + inputMargin = 8 + 2 + minNonLiteralBlockSize = 16 + ) + + // Protect against e.cur wraparound. + for e.cur >= e.bufferReset-int32(len(e.hist)) { + if len(e.hist) == 0 { + e.table = [betterShortTableSize]tableEntry{} + e.longTable = [betterLongTableSize]prevEntry{} + e.cur = e.maxMatchOff + break + } + // Shift down everything in the table that isn't already too far away. + minOff := e.cur + int32(len(e.hist)) - e.maxMatchOff + for i := range e.table[:] { + v := e.table[i].offset + if v < minOff { + v = 0 + } else { + v = v - e.cur + e.maxMatchOff + } + e.table[i].offset = v + } + for i := range e.longTable[:] { + v := e.longTable[i].offset + v2 := e.longTable[i].prev + if v < minOff { + v = 0 + v2 = 0 + } else { + v = v - e.cur + e.maxMatchOff + if v2 < minOff { + v2 = 0 + } else { + v2 = v2 - e.cur + e.maxMatchOff + } + } + e.longTable[i] = prevEntry{ + offset: v, + prev: v2, + } + } + e.cur = e.maxMatchOff + break + } + + s := e.addBlock(src) + blk.size = len(src) + if len(src) < minNonLiteralBlockSize { + blk.extraLits = len(src) + blk.literals = blk.literals[:len(src)] + copy(blk.literals, src) + return + } + + // Override src + src = e.hist + sLimit := int32(len(src)) - inputMargin + // stepSize is the number of bytes to skip on every main loop iteration. + // It should be >= 1. + const stepSize = 1 + + const kSearchStrength = 9 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := s + cv := load6432(src, s) + + // Relative offsets + offset1 := int32(blk.recentOffsets[0]) + offset2 := int32(blk.recentOffsets[1]) + + addLiterals := func(s *seq, until int32) { + if until == nextEmit { + return + } + blk.literals = append(blk.literals, src[nextEmit:until]...) + s.litLen = uint32(until - nextEmit) + } + if debugEncoder { + println("recent offsets:", blk.recentOffsets) + } + +encodeLoop: + for { + var t int32 + // We allow the encoder to optionally turn off repeat offsets across blocks + canRepeat := len(blk.sequences) > 2 + var matched int32 + + for { + if debugAsserts && canRepeat && offset1 == 0 { + panic("offset0 was 0") + } + + nextHashL := hashLen(cv, betterLongTableBits, betterLongLen) + nextHashS := hashLen(cv, betterShortTableBits, betterShortLen) + candidateL := e.longTable[nextHashL] + candidateS := e.table[nextHashS] + + const repOff = 1 + repIndex := s - offset1 + repOff + off := s + e.cur + e.longTable[nextHashL] = prevEntry{offset: off, prev: candidateL.offset} + e.table[nextHashS] = tableEntry{offset: off, val: uint32(cv)} + + if canRepeat { + if repIndex >= 0 && load3232(src, repIndex) == uint32(cv>>(repOff*8)) { + // Consider history as well. + var seq seq + lenght := 4 + e.matchlen(s+4+repOff, repIndex+4, src) + + seq.matchLen = uint32(lenght - zstdMinMatch) + + // We might be able to match backwards. + // Extend as long as we can. + start := s + repOff + // We end the search early, so we don't risk 0 literals + // and have to do special offset treatment. + startLimit := nextEmit + 1 + + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for repIndex > tMin && start > startLimit && src[repIndex-1] == src[start-1] && seq.matchLen < maxMatchLength-zstdMinMatch-1 { + repIndex-- + start-- + seq.matchLen++ + } + addLiterals(&seq, start) + + // rep 0 + seq.offset = 1 + if debugSequences { + println("repeat sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + + // Index match start+1 (long) -> s - 1 + index0 := s + repOff + s += lenght + repOff + + nextEmit = s + if s >= sLimit { + if debugEncoder { + println("repeat ended", s, lenght) + + } + break encodeLoop + } + // Index skipped... + for index0 < s-1 { + cv0 := load6432(src, index0) + cv1 := cv0 >> 8 + h0 := hashLen(cv0, betterLongTableBits, betterLongLen) + off := index0 + e.cur + e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} + e.table[hashLen(cv1, betterShortTableBits, betterShortLen)] = tableEntry{offset: off + 1, val: uint32(cv1)} + index0 += 2 + } + cv = load6432(src, s) + continue + } + const repOff2 = 1 + + // We deviate from the reference encoder and also check offset 2. + // Still slower and not much better, so disabled. + // repIndex = s - offset2 + repOff2 + if false && repIndex >= 0 && load6432(src, repIndex) == load6432(src, s+repOff) { + // Consider history as well. + var seq seq + lenght := 8 + e.matchlen(s+8+repOff2, repIndex+8, src) + + seq.matchLen = uint32(lenght - zstdMinMatch) + + // We might be able to match backwards. + // Extend as long as we can. + start := s + repOff2 + // We end the search early, so we don't risk 0 literals + // and have to do special offset treatment. + startLimit := nextEmit + 1 + + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for repIndex > tMin && start > startLimit && src[repIndex-1] == src[start-1] && seq.matchLen < maxMatchLength-zstdMinMatch-1 { + repIndex-- + start-- + seq.matchLen++ + } + addLiterals(&seq, start) + + // rep 2 + seq.offset = 2 + if debugSequences { + println("repeat sequence 2", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + + index0 := s + repOff2 + s += lenght + repOff2 + nextEmit = s + if s >= sLimit { + if debugEncoder { + println("repeat ended", s, lenght) + + } + break encodeLoop + } + + // Index skipped... + for index0 < s-1 { + cv0 := load6432(src, index0) + cv1 := cv0 >> 8 + h0 := hashLen(cv0, betterLongTableBits, betterLongLen) + off := index0 + e.cur + e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} + e.table[hashLen(cv1, betterShortTableBits, betterShortLen)] = tableEntry{offset: off + 1, val: uint32(cv1)} + index0 += 2 + } + cv = load6432(src, s) + // Swap offsets + offset1, offset2 = offset2, offset1 + continue + } + } + // Find the offsets of our two matches. + coffsetL := candidateL.offset - e.cur + coffsetLP := candidateL.prev - e.cur + + // Check if we have a long match. + if s-coffsetL < e.maxMatchOff && cv == load6432(src, coffsetL) { + // Found a long match, at least 8 bytes. + matched = e.matchlen(s+8, coffsetL+8, src) + 8 + t = coffsetL + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugMatches { + println("long match") + } + + if s-coffsetLP < e.maxMatchOff && cv == load6432(src, coffsetLP) { + // Found a long match, at least 8 bytes. + prevMatch := e.matchlen(s+8, coffsetLP+8, src) + 8 + if prevMatch > matched { + matched = prevMatch + t = coffsetLP + } + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugMatches { + println("long match") + } + } + break + } + + // Check if we have a long match on prev. + if s-coffsetLP < e.maxMatchOff && cv == load6432(src, coffsetLP) { + // Found a long match, at least 8 bytes. + matched = e.matchlen(s+8, coffsetLP+8, src) + 8 + t = coffsetLP + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugMatches { + println("long match") + } + break + } + + coffsetS := candidateS.offset - e.cur + + // Check if we have a short match. + if s-coffsetS < e.maxMatchOff && uint32(cv) == candidateS.val { + // found a regular match + matched = e.matchlen(s+4, coffsetS+4, src) + 4 + + // See if we can find a long match at s+1 + const checkAt = 1 + cv := load6432(src, s+checkAt) + nextHashL = hashLen(cv, betterLongTableBits, betterLongLen) + candidateL = e.longTable[nextHashL] + coffsetL = candidateL.offset - e.cur + + // We can store it, since we have at least a 4 byte match. + e.longTable[nextHashL] = prevEntry{offset: s + checkAt + e.cur, prev: candidateL.offset} + if s-coffsetL < e.maxMatchOff && cv == load6432(src, coffsetL) { + // Found a long match, at least 8 bytes. + matchedNext := e.matchlen(s+8+checkAt, coffsetL+8, src) + 8 + if matchedNext > matched { + t = coffsetL + s += checkAt + matched = matchedNext + if debugMatches { + println("long match (after short)") + } + break + } + } + + // Check prev long... + coffsetL = candidateL.prev - e.cur + if s-coffsetL < e.maxMatchOff && cv == load6432(src, coffsetL) { + // Found a long match, at least 8 bytes. + matchedNext := e.matchlen(s+8+checkAt, coffsetL+8, src) + 8 + if matchedNext > matched { + t = coffsetL + s += checkAt + matched = matchedNext + if debugMatches { + println("prev long match (after short)") + } + break + } + } + t = coffsetS + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugAsserts && t < 0 { + panic("t<0") + } + if debugMatches { + println("short match") + } + break + } + + // No match found, move forward in input. + s += stepSize + ((s - nextEmit) >> (kSearchStrength - 1)) + if s >= sLimit { + break encodeLoop + } + cv = load6432(src, s) + } + + // Try to find a better match by searching for a long match at the end of the current best match + if s+matched < sLimit { + // Allow some bytes at the beginning to mismatch. + // Sweet spot is around 3 bytes, but depends on input. + // The skipped bytes are tested in Extend backwards, + // and still picked up as part of the match if they do. + const skipBeginning = 3 + + nextHashL := hashLen(load6432(src, s+matched), betterLongTableBits, betterLongLen) + s2 := s + skipBeginning + cv := load3232(src, s2) + candidateL := e.longTable[nextHashL] + coffsetL := candidateL.offset - e.cur - matched + skipBeginning + if coffsetL >= 0 && coffsetL < s2 && s2-coffsetL < e.maxMatchOff && cv == load3232(src, coffsetL) { + // Found a long match, at least 4 bytes. + matchedNext := e.matchlen(s2+4, coffsetL+4, src) + 4 + if matchedNext > matched { + t = coffsetL + s = s2 + matched = matchedNext + if debugMatches { + println("long match at end-of-match") + } + } + } + + // Check prev long... + if true { + coffsetL = candidateL.prev - e.cur - matched + skipBeginning + if coffsetL >= 0 && coffsetL < s2 && s2-coffsetL < e.maxMatchOff && cv == load3232(src, coffsetL) { + // Found a long match, at least 4 bytes. + matchedNext := e.matchlen(s2+4, coffsetL+4, src) + 4 + if matchedNext > matched { + t = coffsetL + s = s2 + matched = matchedNext + if debugMatches { + println("prev long match at end-of-match") + } + } + } + } + } + // A match has been found. Update recent offsets. + offset2 = offset1 + offset1 = s - t + + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + + if debugAsserts && canRepeat && int(offset1) > len(src) { + panic("invalid offset") + } + + // Extend the n-byte match as long as possible. + l := matched + + // Extend backwards + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for t > tMin && s > nextEmit && src[t-1] == src[s-1] && l < maxMatchLength { + s-- + t-- + l++ + } + + // Write our sequence + var seq seq + seq.litLen = uint32(s - nextEmit) + seq.matchLen = uint32(l - zstdMinMatch) + if seq.litLen > 0 { + blk.literals = append(blk.literals, src[nextEmit:s]...) + } + seq.offset = uint32(s-t) + 3 + s += l + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + nextEmit = s + if s >= sLimit { + break encodeLoop + } + + // Index match start+1 (long) -> s - 1 + index0 := s - l + 1 + for index0 < s-1 { + cv0 := load6432(src, index0) + cv1 := cv0 >> 8 + h0 := hashLen(cv0, betterLongTableBits, betterLongLen) + off := index0 + e.cur + e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} + e.table[hashLen(cv1, betterShortTableBits, betterShortLen)] = tableEntry{offset: off + 1, val: uint32(cv1)} + index0 += 2 + } + + cv = load6432(src, s) + if !canRepeat { + continue + } + + // Check offset 2 + for { + o2 := s - offset2 + if load3232(src, o2) != uint32(cv) { + // Do regular search + break + } + + // Store this, since we have it. + nextHashL := hashLen(cv, betterLongTableBits, betterLongLen) + nextHashS := hashLen(cv, betterShortTableBits, betterShortLen) + + // We have at least 4 byte match. + // No need to check backwards. We come straight from a match + l := 4 + e.matchlen(s+4, o2+4, src) + + e.longTable[nextHashL] = prevEntry{offset: s + e.cur, prev: e.longTable[nextHashL].offset} + e.table[nextHashS] = tableEntry{offset: s + e.cur, val: uint32(cv)} + seq.matchLen = uint32(l) - zstdMinMatch + seq.litLen = 0 + + // Since litlen is always 0, this is offset 1. + seq.offset = 1 + s += l + nextEmit = s + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + + // Swap offset 1 and 2. + offset1, offset2 = offset2, offset1 + if s >= sLimit { + // Finished + break encodeLoop + } + cv = load6432(src, s) + } + } + + if int(nextEmit) < len(src) { + blk.literals = append(blk.literals, src[nextEmit:]...) + blk.extraLits = len(src) - int(nextEmit) + } + blk.recentOffsets[0] = uint32(offset1) + blk.recentOffsets[1] = uint32(offset2) + if debugEncoder { + println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) + } +} + +// EncodeNoHist will encode a block with no history and no following blocks. +// Most notable difference is that src will not be copied for history and +// we do not need to check for max match length. +func (e *betterFastEncoder) EncodeNoHist(blk *blockEnc, src []byte) { + e.ensureHist(len(src)) + e.Encode(blk, src) +} + +// Encode improves compression... +func (e *betterFastEncoderDict) Encode(blk *blockEnc, src []byte) { + const ( + // Input margin is the number of bytes we read (8) + // and the maximum we will read ahead (2) + inputMargin = 8 + 2 + minNonLiteralBlockSize = 16 + ) + + // Protect against e.cur wraparound. + for e.cur >= e.bufferReset-int32(len(e.hist)) { + if len(e.hist) == 0 { + for i := range e.table[:] { + e.table[i] = tableEntry{} + } + for i := range e.longTable[:] { + e.longTable[i] = prevEntry{} + } + e.cur = e.maxMatchOff + e.allDirty = true + break + } + // Shift down everything in the table that isn't already too far away. + minOff := e.cur + int32(len(e.hist)) - e.maxMatchOff + for i := range e.table[:] { + v := e.table[i].offset + if v < minOff { + v = 0 + } else { + v = v - e.cur + e.maxMatchOff + } + e.table[i].offset = v + } + for i := range e.longTable[:] { + v := e.longTable[i].offset + v2 := e.longTable[i].prev + if v < minOff { + v = 0 + v2 = 0 + } else { + v = v - e.cur + e.maxMatchOff + if v2 < minOff { + v2 = 0 + } else { + v2 = v2 - e.cur + e.maxMatchOff + } + } + e.longTable[i] = prevEntry{ + offset: v, + prev: v2, + } + } + e.allDirty = true + e.cur = e.maxMatchOff + break + } + + s := e.addBlock(src) + blk.size = len(src) + if len(src) < minNonLiteralBlockSize { + blk.extraLits = len(src) + blk.literals = blk.literals[:len(src)] + copy(blk.literals, src) + return + } + + // Override src + src = e.hist + sLimit := int32(len(src)) - inputMargin + // stepSize is the number of bytes to skip on every main loop iteration. + // It should be >= 1. + const stepSize = 1 + + const kSearchStrength = 9 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := s + cv := load6432(src, s) + + // Relative offsets + offset1 := int32(blk.recentOffsets[0]) + offset2 := int32(blk.recentOffsets[1]) + + addLiterals := func(s *seq, until int32) { + if until == nextEmit { + return + } + blk.literals = append(blk.literals, src[nextEmit:until]...) + s.litLen = uint32(until - nextEmit) + } + if debugEncoder { + println("recent offsets:", blk.recentOffsets) + } + +encodeLoop: + for { + var t int32 + // We allow the encoder to optionally turn off repeat offsets across blocks + canRepeat := len(blk.sequences) > 2 + var matched int32 + + for { + if debugAsserts && canRepeat && offset1 == 0 { + panic("offset0 was 0") + } + + nextHashL := hashLen(cv, betterLongTableBits, betterLongLen) + nextHashS := hashLen(cv, betterShortTableBits, betterShortLen) + candidateL := e.longTable[nextHashL] + candidateS := e.table[nextHashS] + + const repOff = 1 + repIndex := s - offset1 + repOff + off := s + e.cur + e.longTable[nextHashL] = prevEntry{offset: off, prev: candidateL.offset} + e.markLongShardDirty(nextHashL) + e.table[nextHashS] = tableEntry{offset: off, val: uint32(cv)} + e.markShortShardDirty(nextHashS) + + if canRepeat { + if repIndex >= 0 && load3232(src, repIndex) == uint32(cv>>(repOff*8)) { + // Consider history as well. + var seq seq + lenght := 4 + e.matchlen(s+4+repOff, repIndex+4, src) + + seq.matchLen = uint32(lenght - zstdMinMatch) + + // We might be able to match backwards. + // Extend as long as we can. + start := s + repOff + // We end the search early, so we don't risk 0 literals + // and have to do special offset treatment. + startLimit := nextEmit + 1 + + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for repIndex > tMin && start > startLimit && src[repIndex-1] == src[start-1] && seq.matchLen < maxMatchLength-zstdMinMatch-1 { + repIndex-- + start-- + seq.matchLen++ + } + addLiterals(&seq, start) + + // rep 0 + seq.offset = 1 + if debugSequences { + println("repeat sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + + // Index match start+1 (long) -> s - 1 + index0 := s + repOff + s += lenght + repOff + + nextEmit = s + if s >= sLimit { + if debugEncoder { + println("repeat ended", s, lenght) + + } + break encodeLoop + } + // Index skipped... + for index0 < s-1 { + cv0 := load6432(src, index0) + cv1 := cv0 >> 8 + h0 := hashLen(cv0, betterLongTableBits, betterLongLen) + off := index0 + e.cur + e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} + e.markLongShardDirty(h0) + h1 := hashLen(cv1, betterShortTableBits, betterShortLen) + e.table[h1] = tableEntry{offset: off + 1, val: uint32(cv1)} + e.markShortShardDirty(h1) + index0 += 2 + } + cv = load6432(src, s) + continue + } + const repOff2 = 1 + + // We deviate from the reference encoder and also check offset 2. + // Still slower and not much better, so disabled. + // repIndex = s - offset2 + repOff2 + if false && repIndex >= 0 && load6432(src, repIndex) == load6432(src, s+repOff) { + // Consider history as well. + var seq seq + lenght := 8 + e.matchlen(s+8+repOff2, repIndex+8, src) + + seq.matchLen = uint32(lenght - zstdMinMatch) + + // We might be able to match backwards. + // Extend as long as we can. + start := s + repOff2 + // We end the search early, so we don't risk 0 literals + // and have to do special offset treatment. + startLimit := nextEmit + 1 + + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for repIndex > tMin && start > startLimit && src[repIndex-1] == src[start-1] && seq.matchLen < maxMatchLength-zstdMinMatch-1 { + repIndex-- + start-- + seq.matchLen++ + } + addLiterals(&seq, start) + + // rep 2 + seq.offset = 2 + if debugSequences { + println("repeat sequence 2", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + + index0 := s + repOff2 + s += lenght + repOff2 + nextEmit = s + if s >= sLimit { + if debugEncoder { + println("repeat ended", s, lenght) + + } + break encodeLoop + } + + // Index skipped... + for index0 < s-1 { + cv0 := load6432(src, index0) + cv1 := cv0 >> 8 + h0 := hashLen(cv0, betterLongTableBits, betterLongLen) + off := index0 + e.cur + e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} + e.markLongShardDirty(h0) + h1 := hashLen(cv1, betterShortTableBits, betterShortLen) + e.table[h1] = tableEntry{offset: off + 1, val: uint32(cv1)} + e.markShortShardDirty(h1) + index0 += 2 + } + cv = load6432(src, s) + // Swap offsets + offset1, offset2 = offset2, offset1 + continue + } + } + // Find the offsets of our two matches. + coffsetL := candidateL.offset - e.cur + coffsetLP := candidateL.prev - e.cur + + // Check if we have a long match. + if s-coffsetL < e.maxMatchOff && cv == load6432(src, coffsetL) { + // Found a long match, at least 8 bytes. + matched = e.matchlen(s+8, coffsetL+8, src) + 8 + t = coffsetL + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugMatches { + println("long match") + } + + if s-coffsetLP < e.maxMatchOff && cv == load6432(src, coffsetLP) { + // Found a long match, at least 8 bytes. + prevMatch := e.matchlen(s+8, coffsetLP+8, src) + 8 + if prevMatch > matched { + matched = prevMatch + t = coffsetLP + } + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugMatches { + println("long match") + } + } + break + } + + // Check if we have a long match on prev. + if s-coffsetLP < e.maxMatchOff && cv == load6432(src, coffsetLP) { + // Found a long match, at least 8 bytes. + matched = e.matchlen(s+8, coffsetLP+8, src) + 8 + t = coffsetLP + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugMatches { + println("long match") + } + break + } + + coffsetS := candidateS.offset - e.cur + + // Check if we have a short match. + if s-coffsetS < e.maxMatchOff && uint32(cv) == candidateS.val { + // found a regular match + matched = e.matchlen(s+4, coffsetS+4, src) + 4 + + // See if we can find a long match at s+1 + const checkAt = 1 + cv := load6432(src, s+checkAt) + nextHashL = hashLen(cv, betterLongTableBits, betterLongLen) + candidateL = e.longTable[nextHashL] + coffsetL = candidateL.offset - e.cur + + // We can store it, since we have at least a 4 byte match. + e.longTable[nextHashL] = prevEntry{offset: s + checkAt + e.cur, prev: candidateL.offset} + e.markLongShardDirty(nextHashL) + if s-coffsetL < e.maxMatchOff && cv == load6432(src, coffsetL) { + // Found a long match, at least 8 bytes. + matchedNext := e.matchlen(s+8+checkAt, coffsetL+8, src) + 8 + if matchedNext > matched { + t = coffsetL + s += checkAt + matched = matchedNext + if debugMatches { + println("long match (after short)") + } + break + } + } + + // Check prev long... + coffsetL = candidateL.prev - e.cur + if s-coffsetL < e.maxMatchOff && cv == load6432(src, coffsetL) { + // Found a long match, at least 8 bytes. + matchedNext := e.matchlen(s+8+checkAt, coffsetL+8, src) + 8 + if matchedNext > matched { + t = coffsetL + s += checkAt + matched = matchedNext + if debugMatches { + println("prev long match (after short)") + } + break + } + } + t = coffsetS + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugAsserts && t < 0 { + panic("t<0") + } + if debugMatches { + println("short match") + } + break + } + + // No match found, move forward in input. + s += stepSize + ((s - nextEmit) >> (kSearchStrength - 1)) + if s >= sLimit { + break encodeLoop + } + cv = load6432(src, s) + } + // Try to find a better match by searching for a long match at the end of the current best match + if s+matched < sLimit { + nextHashL := hashLen(load6432(src, s+matched), betterLongTableBits, betterLongLen) + cv := load3232(src, s) + candidateL := e.longTable[nextHashL] + coffsetL := candidateL.offset - e.cur - matched + if coffsetL >= 0 && coffsetL < s && s-coffsetL < e.maxMatchOff && cv == load3232(src, coffsetL) { + // Found a long match, at least 4 bytes. + matchedNext := e.matchlen(s+4, coffsetL+4, src) + 4 + if matchedNext > matched { + t = coffsetL + matched = matchedNext + if debugMatches { + println("long match at end-of-match") + } + } + } + + // Check prev long... + if true { + coffsetL = candidateL.prev - e.cur - matched + if coffsetL >= 0 && coffsetL < s && s-coffsetL < e.maxMatchOff && cv == load3232(src, coffsetL) { + // Found a long match, at least 4 bytes. + matchedNext := e.matchlen(s+4, coffsetL+4, src) + 4 + if matchedNext > matched { + t = coffsetL + matched = matchedNext + if debugMatches { + println("prev long match at end-of-match") + } + } + } + } + } + // A match has been found. Update recent offsets. + offset2 = offset1 + offset1 = s - t + + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + + if debugAsserts && canRepeat && int(offset1) > len(src) { + panic("invalid offset") + } + + // Extend the n-byte match as long as possible. + l := matched + + // Extend backwards + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for t > tMin && s > nextEmit && src[t-1] == src[s-1] && l < maxMatchLength { + s-- + t-- + l++ + } + + // Write our sequence + var seq seq + seq.litLen = uint32(s - nextEmit) + seq.matchLen = uint32(l - zstdMinMatch) + if seq.litLen > 0 { + blk.literals = append(blk.literals, src[nextEmit:s]...) + } + seq.offset = uint32(s-t) + 3 + s += l + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + nextEmit = s + if s >= sLimit { + break encodeLoop + } + + // Index match start+1 (long) -> s - 1 + index0 := s - l + 1 + for index0 < s-1 { + cv0 := load6432(src, index0) + cv1 := cv0 >> 8 + h0 := hashLen(cv0, betterLongTableBits, betterLongLen) + off := index0 + e.cur + e.longTable[h0] = prevEntry{offset: off, prev: e.longTable[h0].offset} + e.markLongShardDirty(h0) + h1 := hashLen(cv1, betterShortTableBits, betterShortLen) + e.table[h1] = tableEntry{offset: off + 1, val: uint32(cv1)} + e.markShortShardDirty(h1) + index0 += 2 + } + + cv = load6432(src, s) + if !canRepeat { + continue + } + + // Check offset 2 + for { + o2 := s - offset2 + if load3232(src, o2) != uint32(cv) { + // Do regular search + break + } + + // Store this, since we have it. + nextHashL := hashLen(cv, betterLongTableBits, betterLongLen) + nextHashS := hashLen(cv, betterShortTableBits, betterShortLen) + + // We have at least 4 byte match. + // No need to check backwards. We come straight from a match + l := 4 + e.matchlen(s+4, o2+4, src) + + e.longTable[nextHashL] = prevEntry{offset: s + e.cur, prev: e.longTable[nextHashL].offset} + e.markLongShardDirty(nextHashL) + e.table[nextHashS] = tableEntry{offset: s + e.cur, val: uint32(cv)} + e.markShortShardDirty(nextHashS) + seq.matchLen = uint32(l) - zstdMinMatch + seq.litLen = 0 + + // Since litlen is always 0, this is offset 1. + seq.offset = 1 + s += l + nextEmit = s + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + + // Swap offset 1 and 2. + offset1, offset2 = offset2, offset1 + if s >= sLimit { + // Finished + break encodeLoop + } + cv = load6432(src, s) + } + } + + if int(nextEmit) < len(src) { + blk.literals = append(blk.literals, src[nextEmit:]...) + blk.extraLits = len(src) - int(nextEmit) + } + blk.recentOffsets[0] = uint32(offset1) + blk.recentOffsets[1] = uint32(offset2) + if debugEncoder { + println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) + } +} + +// ResetDict will reset and set a dictionary if not nil +func (e *betterFastEncoder) Reset(d *dict, singleBlock bool) { + e.resetBase(d, singleBlock) + if d != nil { + panic("betterFastEncoder: Reset with dict") + } +} + +// ResetDict will reset and set a dictionary if not nil +func (e *betterFastEncoderDict) Reset(d *dict, singleBlock bool) { + e.resetBase(d, singleBlock) + if d == nil { + return + } + // Init or copy dict table + if len(e.dictTable) != len(e.table) || d.id != e.lastDictID { + if len(e.dictTable) != len(e.table) { + e.dictTable = make([]tableEntry, len(e.table)) + } + end := int32(len(d.content)) - 8 + e.maxMatchOff + for i := e.maxMatchOff; i < end; i += 4 { + const hashLog = betterShortTableBits + + cv := load6432(d.content, i-e.maxMatchOff) + nextHash := hashLen(cv, hashLog, betterShortLen) // 0 -> 4 + nextHash1 := hashLen(cv>>8, hashLog, betterShortLen) // 1 -> 5 + nextHash2 := hashLen(cv>>16, hashLog, betterShortLen) // 2 -> 6 + nextHash3 := hashLen(cv>>24, hashLog, betterShortLen) // 3 -> 7 + e.dictTable[nextHash] = tableEntry{ + val: uint32(cv), + offset: i, + } + e.dictTable[nextHash1] = tableEntry{ + val: uint32(cv >> 8), + offset: i + 1, + } + e.dictTable[nextHash2] = tableEntry{ + val: uint32(cv >> 16), + offset: i + 2, + } + e.dictTable[nextHash3] = tableEntry{ + val: uint32(cv >> 24), + offset: i + 3, + } + } + e.lastDictID = d.id + e.allDirty = true + } + + // Init or copy dict table + if len(e.dictLongTable) != len(e.longTable) || d.id != e.lastDictID { + if len(e.dictLongTable) != len(e.longTable) { + e.dictLongTable = make([]prevEntry, len(e.longTable)) + } + if len(d.content) >= 8 { + cv := load6432(d.content, 0) + h := hashLen(cv, betterLongTableBits, betterLongLen) + e.dictLongTable[h] = prevEntry{ + offset: e.maxMatchOff, + prev: e.dictLongTable[h].offset, + } + + end := int32(len(d.content)) - 8 + e.maxMatchOff + off := 8 // First to read + for i := e.maxMatchOff + 1; i < end; i++ { + cv = cv>>8 | (uint64(d.content[off]) << 56) + h := hashLen(cv, betterLongTableBits, betterLongLen) + e.dictLongTable[h] = prevEntry{ + offset: i, + prev: e.dictLongTable[h].offset, + } + off++ + } + } + e.lastDictID = d.id + e.allDirty = true + } + + // Reset table to initial state + { + dirtyShardCnt := 0 + if !e.allDirty { + for i := range e.shortTableShardDirty { + if e.shortTableShardDirty[i] { + dirtyShardCnt++ + } + } + } + const shardCnt = betterShortTableShardCnt + const shardSize = betterShortTableShardSize + if e.allDirty || dirtyShardCnt > shardCnt*4/6 { + copy(e.table[:], e.dictTable) + for i := range e.shortTableShardDirty { + e.shortTableShardDirty[i] = false + } + } else { + for i := range e.shortTableShardDirty { + if !e.shortTableShardDirty[i] { + continue + } + + copy(e.table[i*shardSize:(i+1)*shardSize], e.dictTable[i*shardSize:(i+1)*shardSize]) + e.shortTableShardDirty[i] = false + } + } + } + { + dirtyShardCnt := 0 + if !e.allDirty { + for i := range e.shortTableShardDirty { + if e.shortTableShardDirty[i] { + dirtyShardCnt++ + } + } + } + const shardCnt = betterLongTableShardCnt + const shardSize = betterLongTableShardSize + if e.allDirty || dirtyShardCnt > shardCnt*4/6 { + copy(e.longTable[:], e.dictLongTable) + for i := range e.longTableShardDirty { + e.longTableShardDirty[i] = false + } + } else { + for i := range e.longTableShardDirty { + if !e.longTableShardDirty[i] { + continue + } + + copy(e.longTable[i*shardSize:(i+1)*shardSize], e.dictLongTable[i*shardSize:(i+1)*shardSize]) + e.longTableShardDirty[i] = false + } + } + } + e.cur = e.maxMatchOff + e.allDirty = false +} + +func (e *betterFastEncoderDict) markLongShardDirty(entryNum uint32) { + e.longTableShardDirty[entryNum/betterLongTableShardSize] = true +} + +func (e *betterFastEncoderDict) markShortShardDirty(entryNum uint32) { + e.shortTableShardDirty[entryNum/betterShortTableShardSize] = true +} diff --git a/vendor/github.com/klauspost/compress/zstd/enc_dfast.go b/vendor/github.com/klauspost/compress/zstd/enc_dfast.go new file mode 100644 index 000000000..a154c18f7 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/enc_dfast.go @@ -0,0 +1,1123 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import "fmt" + +const ( + dFastLongTableBits = 17 // Bits used in the long match table + dFastLongTableSize = 1 << dFastLongTableBits // Size of the table + dFastLongTableMask = dFastLongTableSize - 1 // Mask for table indices. Redundant, but can eliminate bounds checks. + dFastLongLen = 8 // Bytes used for table hash + + dLongTableShardCnt = 1 << (dFastLongTableBits - dictShardBits) // Number of shards in the table + dLongTableShardSize = dFastLongTableSize / tableShardCnt // Size of an individual shard + + dFastShortTableBits = tableBits // Bits used in the short match table + dFastShortTableSize = 1 << dFastShortTableBits // Size of the table + dFastShortTableMask = dFastShortTableSize - 1 // Mask for table indices. Redundant, but can eliminate bounds checks. + dFastShortLen = 5 // Bytes used for table hash + +) + +type doubleFastEncoder struct { + fastEncoder + longTable [dFastLongTableSize]tableEntry +} + +type doubleFastEncoderDict struct { + fastEncoderDict + longTable [dFastLongTableSize]tableEntry + dictLongTable []tableEntry + longTableShardDirty [dLongTableShardCnt]bool +} + +// Encode mimmics functionality in zstd_dfast.c +func (e *doubleFastEncoder) Encode(blk *blockEnc, src []byte) { + const ( + // Input margin is the number of bytes we read (8) + // and the maximum we will read ahead (2) + inputMargin = 8 + 2 + minNonLiteralBlockSize = 16 + ) + + // Protect against e.cur wraparound. + for e.cur >= e.bufferReset-int32(len(e.hist)) { + if len(e.hist) == 0 { + e.table = [dFastShortTableSize]tableEntry{} + e.longTable = [dFastLongTableSize]tableEntry{} + e.cur = e.maxMatchOff + break + } + // Shift down everything in the table that isn't already too far away. + minOff := e.cur + int32(len(e.hist)) - e.maxMatchOff + for i := range e.table[:] { + v := e.table[i].offset + if v < minOff { + v = 0 + } else { + v = v - e.cur + e.maxMatchOff + } + e.table[i].offset = v + } + for i := range e.longTable[:] { + v := e.longTable[i].offset + if v < minOff { + v = 0 + } else { + v = v - e.cur + e.maxMatchOff + } + e.longTable[i].offset = v + } + e.cur = e.maxMatchOff + break + } + + s := e.addBlock(src) + blk.size = len(src) + if len(src) < minNonLiteralBlockSize { + blk.extraLits = len(src) + blk.literals = blk.literals[:len(src)] + copy(blk.literals, src) + return + } + + // Override src + src = e.hist + sLimit := int32(len(src)) - inputMargin + // stepSize is the number of bytes to skip on every main loop iteration. + // It should be >= 1. + const stepSize = 1 + + const kSearchStrength = 8 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := s + cv := load6432(src, s) + + // Relative offsets + offset1 := int32(blk.recentOffsets[0]) + offset2 := int32(blk.recentOffsets[1]) + + addLiterals := func(s *seq, until int32) { + if until == nextEmit { + return + } + blk.literals = append(blk.literals, src[nextEmit:until]...) + s.litLen = uint32(until - nextEmit) + } + if debugEncoder { + println("recent offsets:", blk.recentOffsets) + } + +encodeLoop: + for { + var t int32 + // We allow the encoder to optionally turn off repeat offsets across blocks + canRepeat := len(blk.sequences) > 2 + + for { + if debugAsserts && canRepeat && offset1 == 0 { + panic("offset0 was 0") + } + + nextHashL := hashLen(cv, dFastLongTableBits, dFastLongLen) + nextHashS := hashLen(cv, dFastShortTableBits, dFastShortLen) + candidateL := e.longTable[nextHashL] + candidateS := e.table[nextHashS] + + const repOff = 1 + repIndex := s - offset1 + repOff + entry := tableEntry{offset: s + e.cur, val: uint32(cv)} + e.longTable[nextHashL] = entry + e.table[nextHashS] = entry + + if canRepeat { + if repIndex >= 0 && load3232(src, repIndex) == uint32(cv>>(repOff*8)) { + // Consider history as well. + var seq seq + lenght := 4 + e.matchlen(s+4+repOff, repIndex+4, src) + + seq.matchLen = uint32(lenght - zstdMinMatch) + + // We might be able to match backwards. + // Extend as long as we can. + start := s + repOff + // We end the search early, so we don't risk 0 literals + // and have to do special offset treatment. + startLimit := nextEmit + 1 + + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for repIndex > tMin && start > startLimit && src[repIndex-1] == src[start-1] && seq.matchLen < maxMatchLength-zstdMinMatch-1 { + repIndex-- + start-- + seq.matchLen++ + } + addLiterals(&seq, start) + + // rep 0 + seq.offset = 1 + if debugSequences { + println("repeat sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + s += lenght + repOff + nextEmit = s + if s >= sLimit { + if debugEncoder { + println("repeat ended", s, lenght) + + } + break encodeLoop + } + cv = load6432(src, s) + continue + } + } + // Find the offsets of our two matches. + coffsetL := s - (candidateL.offset - e.cur) + coffsetS := s - (candidateS.offset - e.cur) + + // Check if we have a long match. + if coffsetL < e.maxMatchOff && uint32(cv) == candidateL.val { + // Found a long match, likely at least 8 bytes. + // Reference encoder checks all 8 bytes, we only check 4, + // but the likelihood of both the first 4 bytes and the hash matching should be enough. + t = candidateL.offset - e.cur + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugMatches { + println("long match") + } + break + } + + // Check if we have a short match. + if coffsetS < e.maxMatchOff && uint32(cv) == candidateS.val { + // found a regular match + // See if we can find a long match at s+1 + const checkAt = 1 + cv := load6432(src, s+checkAt) + nextHashL = hashLen(cv, dFastLongTableBits, dFastLongLen) + candidateL = e.longTable[nextHashL] + coffsetL = s - (candidateL.offset - e.cur) + checkAt + + // We can store it, since we have at least a 4 byte match. + e.longTable[nextHashL] = tableEntry{offset: s + checkAt + e.cur, val: uint32(cv)} + if coffsetL < e.maxMatchOff && uint32(cv) == candidateL.val { + // Found a long match, likely at least 8 bytes. + // Reference encoder checks all 8 bytes, we only check 4, + // but the likelihood of both the first 4 bytes and the hash matching should be enough. + t = candidateL.offset - e.cur + s += checkAt + if debugMatches { + println("long match (after short)") + } + break + } + + t = candidateS.offset - e.cur + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugAsserts && t < 0 { + panic("t<0") + } + if debugMatches { + println("short match") + } + break + } + + // No match found, move forward in input. + s += stepSize + ((s - nextEmit) >> (kSearchStrength - 1)) + if s >= sLimit { + break encodeLoop + } + cv = load6432(src, s) + } + + // A 4-byte match has been found. Update recent offsets. + // We'll later see if more than 4 bytes. + offset2 = offset1 + offset1 = s - t + + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + + if debugAsserts && canRepeat && int(offset1) > len(src) { + panic("invalid offset") + } + + // Extend the 4-byte match as long as possible. + l := e.matchlen(s+4, t+4, src) + 4 + + // Extend backwards + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for t > tMin && s > nextEmit && src[t-1] == src[s-1] && l < maxMatchLength { + s-- + t-- + l++ + } + + // Write our sequence + var seq seq + seq.litLen = uint32(s - nextEmit) + seq.matchLen = uint32(l - zstdMinMatch) + if seq.litLen > 0 { + blk.literals = append(blk.literals, src[nextEmit:s]...) + } + seq.offset = uint32(s-t) + 3 + s += l + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + nextEmit = s + if s >= sLimit { + break encodeLoop + } + + // Index match start+1 (long) and start+2 (short) + index0 := s - l + 1 + // Index match end-2 (long) and end-1 (short) + index1 := s - 2 + + cv0 := load6432(src, index0) + cv1 := load6432(src, index1) + te0 := tableEntry{offset: index0 + e.cur, val: uint32(cv0)} + te1 := tableEntry{offset: index1 + e.cur, val: uint32(cv1)} + e.longTable[hashLen(cv0, dFastLongTableBits, dFastLongLen)] = te0 + e.longTable[hashLen(cv1, dFastLongTableBits, dFastLongLen)] = te1 + cv0 >>= 8 + cv1 >>= 8 + te0.offset++ + te1.offset++ + te0.val = uint32(cv0) + te1.val = uint32(cv1) + e.table[hashLen(cv0, dFastShortTableBits, dFastShortLen)] = te0 + e.table[hashLen(cv1, dFastShortTableBits, dFastShortLen)] = te1 + + cv = load6432(src, s) + + if !canRepeat { + continue + } + + // Check offset 2 + for { + o2 := s - offset2 + if load3232(src, o2) != uint32(cv) { + // Do regular search + break + } + + // Store this, since we have it. + nextHashS := hashLen(cv, dFastShortTableBits, dFastShortLen) + nextHashL := hashLen(cv, dFastLongTableBits, dFastLongLen) + + // We have at least 4 byte match. + // No need to check backwards. We come straight from a match + l := 4 + e.matchlen(s+4, o2+4, src) + + entry := tableEntry{offset: s + e.cur, val: uint32(cv)} + e.longTable[nextHashL] = entry + e.table[nextHashS] = entry + seq.matchLen = uint32(l) - zstdMinMatch + seq.litLen = 0 + + // Since litlen is always 0, this is offset 1. + seq.offset = 1 + s += l + nextEmit = s + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + + // Swap offset 1 and 2. + offset1, offset2 = offset2, offset1 + if s >= sLimit { + // Finished + break encodeLoop + } + cv = load6432(src, s) + } + } + + if int(nextEmit) < len(src) { + blk.literals = append(blk.literals, src[nextEmit:]...) + blk.extraLits = len(src) - int(nextEmit) + } + blk.recentOffsets[0] = uint32(offset1) + blk.recentOffsets[1] = uint32(offset2) + if debugEncoder { + println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) + } +} + +// EncodeNoHist will encode a block with no history and no following blocks. +// Most notable difference is that src will not be copied for history and +// we do not need to check for max match length. +func (e *doubleFastEncoder) EncodeNoHist(blk *blockEnc, src []byte) { + const ( + // Input margin is the number of bytes we read (8) + // and the maximum we will read ahead (2) + inputMargin = 8 + 2 + minNonLiteralBlockSize = 16 + ) + + // Protect against e.cur wraparound. + if e.cur >= e.bufferReset { + for i := range e.table[:] { + e.table[i] = tableEntry{} + } + for i := range e.longTable[:] { + e.longTable[i] = tableEntry{} + } + e.cur = e.maxMatchOff + } + + s := int32(0) + blk.size = len(src) + if len(src) < minNonLiteralBlockSize { + blk.extraLits = len(src) + blk.literals = blk.literals[:len(src)] + copy(blk.literals, src) + return + } + + // Override src + sLimit := int32(len(src)) - inputMargin + // stepSize is the number of bytes to skip on every main loop iteration. + // It should be >= 1. + const stepSize = 1 + + const kSearchStrength = 8 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := s + cv := load6432(src, s) + + // Relative offsets + offset1 := int32(blk.recentOffsets[0]) + offset2 := int32(blk.recentOffsets[1]) + + addLiterals := func(s *seq, until int32) { + if until == nextEmit { + return + } + blk.literals = append(blk.literals, src[nextEmit:until]...) + s.litLen = uint32(until - nextEmit) + } + if debugEncoder { + println("recent offsets:", blk.recentOffsets) + } + +encodeLoop: + for { + var t int32 + for { + + nextHashL := hashLen(cv, dFastLongTableBits, dFastLongLen) + nextHashS := hashLen(cv, dFastShortTableBits, dFastShortLen) + candidateL := e.longTable[nextHashL] + candidateS := e.table[nextHashS] + + const repOff = 1 + repIndex := s - offset1 + repOff + entry := tableEntry{offset: s + e.cur, val: uint32(cv)} + e.longTable[nextHashL] = entry + e.table[nextHashS] = entry + + if len(blk.sequences) > 2 { + if load3232(src, repIndex) == uint32(cv>>(repOff*8)) { + // Consider history as well. + var seq seq + //length := 4 + e.matchlen(s+4+repOff, repIndex+4, src) + length := 4 + int32(matchLen(src[s+4+repOff:], src[repIndex+4:])) + + seq.matchLen = uint32(length - zstdMinMatch) + + // We might be able to match backwards. + // Extend as long as we can. + start := s + repOff + // We end the search early, so we don't risk 0 literals + // and have to do special offset treatment. + startLimit := nextEmit + 1 + + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for repIndex > tMin && start > startLimit && src[repIndex-1] == src[start-1] { + repIndex-- + start-- + seq.matchLen++ + } + addLiterals(&seq, start) + + // rep 0 + seq.offset = 1 + if debugSequences { + println("repeat sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + s += length + repOff + nextEmit = s + if s >= sLimit { + if debugEncoder { + println("repeat ended", s, length) + + } + break encodeLoop + } + cv = load6432(src, s) + continue + } + } + // Find the offsets of our two matches. + coffsetL := s - (candidateL.offset - e.cur) + coffsetS := s - (candidateS.offset - e.cur) + + // Check if we have a long match. + if coffsetL < e.maxMatchOff && uint32(cv) == candidateL.val { + // Found a long match, likely at least 8 bytes. + // Reference encoder checks all 8 bytes, we only check 4, + // but the likelihood of both the first 4 bytes and the hash matching should be enough. + t = candidateL.offset - e.cur + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d). cur: %d", s, t, e.cur)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugMatches { + println("long match") + } + break + } + + // Check if we have a short match. + if coffsetS < e.maxMatchOff && uint32(cv) == candidateS.val { + // found a regular match + // See if we can find a long match at s+1 + const checkAt = 1 + cv := load6432(src, s+checkAt) + nextHashL = hashLen(cv, dFastLongTableBits, dFastLongLen) + candidateL = e.longTable[nextHashL] + coffsetL = s - (candidateL.offset - e.cur) + checkAt + + // We can store it, since we have at least a 4 byte match. + e.longTable[nextHashL] = tableEntry{offset: s + checkAt + e.cur, val: uint32(cv)} + if coffsetL < e.maxMatchOff && uint32(cv) == candidateL.val { + // Found a long match, likely at least 8 bytes. + // Reference encoder checks all 8 bytes, we only check 4, + // but the likelihood of both the first 4 bytes and the hash matching should be enough. + t = candidateL.offset - e.cur + s += checkAt + if debugMatches { + println("long match (after short)") + } + break + } + + t = candidateS.offset - e.cur + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugAsserts && t < 0 { + panic("t<0") + } + if debugMatches { + println("short match") + } + break + } + + // No match found, move forward in input. + s += stepSize + ((s - nextEmit) >> (kSearchStrength - 1)) + if s >= sLimit { + break encodeLoop + } + cv = load6432(src, s) + } + + // A 4-byte match has been found. Update recent offsets. + // We'll later see if more than 4 bytes. + offset2 = offset1 + offset1 = s - t + + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + + // Extend the 4-byte match as long as possible. + //l := e.matchlen(s+4, t+4, src) + 4 + l := int32(matchLen(src[s+4:], src[t+4:])) + 4 + + // Extend backwards + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for t > tMin && s > nextEmit && src[t-1] == src[s-1] { + s-- + t-- + l++ + } + + // Write our sequence + var seq seq + seq.litLen = uint32(s - nextEmit) + seq.matchLen = uint32(l - zstdMinMatch) + if seq.litLen > 0 { + blk.literals = append(blk.literals, src[nextEmit:s]...) + } + seq.offset = uint32(s-t) + 3 + s += l + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + nextEmit = s + if s >= sLimit { + break encodeLoop + } + + // Index match start+1 (long) and start+2 (short) + index0 := s - l + 1 + // Index match end-2 (long) and end-1 (short) + index1 := s - 2 + + cv0 := load6432(src, index0) + cv1 := load6432(src, index1) + te0 := tableEntry{offset: index0 + e.cur, val: uint32(cv0)} + te1 := tableEntry{offset: index1 + e.cur, val: uint32(cv1)} + e.longTable[hashLen(cv0, dFastLongTableBits, dFastLongLen)] = te0 + e.longTable[hashLen(cv1, dFastLongTableBits, dFastLongLen)] = te1 + cv0 >>= 8 + cv1 >>= 8 + te0.offset++ + te1.offset++ + te0.val = uint32(cv0) + te1.val = uint32(cv1) + e.table[hashLen(cv0, dFastShortTableBits, dFastShortLen)] = te0 + e.table[hashLen(cv1, dFastShortTableBits, dFastShortLen)] = te1 + + cv = load6432(src, s) + + if len(blk.sequences) <= 2 { + continue + } + + // Check offset 2 + for { + o2 := s - offset2 + if load3232(src, o2) != uint32(cv) { + // Do regular search + break + } + + // Store this, since we have it. + nextHashS := hashLen(cv1>>8, dFastShortTableBits, dFastShortLen) + nextHashL := hashLen(cv, dFastLongTableBits, dFastLongLen) + + // We have at least 4 byte match. + // No need to check backwards. We come straight from a match + //l := 4 + e.matchlen(s+4, o2+4, src) + l := 4 + int32(matchLen(src[s+4:], src[o2+4:])) + + entry := tableEntry{offset: s + e.cur, val: uint32(cv)} + e.longTable[nextHashL] = entry + e.table[nextHashS] = entry + seq.matchLen = uint32(l) - zstdMinMatch + seq.litLen = 0 + + // Since litlen is always 0, this is offset 1. + seq.offset = 1 + s += l + nextEmit = s + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + + // Swap offset 1 and 2. + offset1, offset2 = offset2, offset1 + if s >= sLimit { + // Finished + break encodeLoop + } + cv = load6432(src, s) + } + } + + if int(nextEmit) < len(src) { + blk.literals = append(blk.literals, src[nextEmit:]...) + blk.extraLits = len(src) - int(nextEmit) + } + if debugEncoder { + println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) + } + + // We do not store history, so we must offset e.cur to avoid false matches for next user. + if e.cur < e.bufferReset { + e.cur += int32(len(src)) + } +} + +// Encode will encode the content, with a dictionary if initialized for it. +func (e *doubleFastEncoderDict) Encode(blk *blockEnc, src []byte) { + const ( + // Input margin is the number of bytes we read (8) + // and the maximum we will read ahead (2) + inputMargin = 8 + 2 + minNonLiteralBlockSize = 16 + ) + + // Protect against e.cur wraparound. + for e.cur >= e.bufferReset-int32(len(e.hist)) { + if len(e.hist) == 0 { + for i := range e.table[:] { + e.table[i] = tableEntry{} + } + for i := range e.longTable[:] { + e.longTable[i] = tableEntry{} + } + e.markAllShardsDirty() + e.cur = e.maxMatchOff + break + } + // Shift down everything in the table that isn't already too far away. + minOff := e.cur + int32(len(e.hist)) - e.maxMatchOff + for i := range e.table[:] { + v := e.table[i].offset + if v < minOff { + v = 0 + } else { + v = v - e.cur + e.maxMatchOff + } + e.table[i].offset = v + } + for i := range e.longTable[:] { + v := e.longTable[i].offset + if v < minOff { + v = 0 + } else { + v = v - e.cur + e.maxMatchOff + } + e.longTable[i].offset = v + } + e.markAllShardsDirty() + e.cur = e.maxMatchOff + break + } + + s := e.addBlock(src) + blk.size = len(src) + if len(src) < minNonLiteralBlockSize { + blk.extraLits = len(src) + blk.literals = blk.literals[:len(src)] + copy(blk.literals, src) + return + } + + // Override src + src = e.hist + sLimit := int32(len(src)) - inputMargin + // stepSize is the number of bytes to skip on every main loop iteration. + // It should be >= 1. + const stepSize = 1 + + const kSearchStrength = 8 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := s + cv := load6432(src, s) + + // Relative offsets + offset1 := int32(blk.recentOffsets[0]) + offset2 := int32(blk.recentOffsets[1]) + + addLiterals := func(s *seq, until int32) { + if until == nextEmit { + return + } + blk.literals = append(blk.literals, src[nextEmit:until]...) + s.litLen = uint32(until - nextEmit) + } + if debugEncoder { + println("recent offsets:", blk.recentOffsets) + } + +encodeLoop: + for { + var t int32 + // We allow the encoder to optionally turn off repeat offsets across blocks + canRepeat := len(blk.sequences) > 2 + + for { + if debugAsserts && canRepeat && offset1 == 0 { + panic("offset0 was 0") + } + + nextHashL := hashLen(cv, dFastLongTableBits, dFastLongLen) + nextHashS := hashLen(cv, dFastShortTableBits, dFastShortLen) + candidateL := e.longTable[nextHashL] + candidateS := e.table[nextHashS] + + const repOff = 1 + repIndex := s - offset1 + repOff + entry := tableEntry{offset: s + e.cur, val: uint32(cv)} + e.longTable[nextHashL] = entry + e.markLongShardDirty(nextHashL) + e.table[nextHashS] = entry + e.markShardDirty(nextHashS) + + if canRepeat { + if repIndex >= 0 && load3232(src, repIndex) == uint32(cv>>(repOff*8)) { + // Consider history as well. + var seq seq + lenght := 4 + e.matchlen(s+4+repOff, repIndex+4, src) + + seq.matchLen = uint32(lenght - zstdMinMatch) + + // We might be able to match backwards. + // Extend as long as we can. + start := s + repOff + // We end the search early, so we don't risk 0 literals + // and have to do special offset treatment. + startLimit := nextEmit + 1 + + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for repIndex > tMin && start > startLimit && src[repIndex-1] == src[start-1] && seq.matchLen < maxMatchLength-zstdMinMatch-1 { + repIndex-- + start-- + seq.matchLen++ + } + addLiterals(&seq, start) + + // rep 0 + seq.offset = 1 + if debugSequences { + println("repeat sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + s += lenght + repOff + nextEmit = s + if s >= sLimit { + if debugEncoder { + println("repeat ended", s, lenght) + + } + break encodeLoop + } + cv = load6432(src, s) + continue + } + } + // Find the offsets of our two matches. + coffsetL := s - (candidateL.offset - e.cur) + coffsetS := s - (candidateS.offset - e.cur) + + // Check if we have a long match. + if coffsetL < e.maxMatchOff && uint32(cv) == candidateL.val { + // Found a long match, likely at least 8 bytes. + // Reference encoder checks all 8 bytes, we only check 4, + // but the likelihood of both the first 4 bytes and the hash matching should be enough. + t = candidateL.offset - e.cur + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugMatches { + println("long match") + } + break + } + + // Check if we have a short match. + if coffsetS < e.maxMatchOff && uint32(cv) == candidateS.val { + // found a regular match + // See if we can find a long match at s+1 + const checkAt = 1 + cv := load6432(src, s+checkAt) + nextHashL = hashLen(cv, dFastLongTableBits, dFastLongLen) + candidateL = e.longTable[nextHashL] + coffsetL = s - (candidateL.offset - e.cur) + checkAt + + // We can store it, since we have at least a 4 byte match. + e.longTable[nextHashL] = tableEntry{offset: s + checkAt + e.cur, val: uint32(cv)} + e.markLongShardDirty(nextHashL) + if coffsetL < e.maxMatchOff && uint32(cv) == candidateL.val { + // Found a long match, likely at least 8 bytes. + // Reference encoder checks all 8 bytes, we only check 4, + // but the likelihood of both the first 4 bytes and the hash matching should be enough. + t = candidateL.offset - e.cur + s += checkAt + if debugMatches { + println("long match (after short)") + } + break + } + + t = candidateS.offset - e.cur + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugAsserts && t < 0 { + panic("t<0") + } + if debugMatches { + println("short match") + } + break + } + + // No match found, move forward in input. + s += stepSize + ((s - nextEmit) >> (kSearchStrength - 1)) + if s >= sLimit { + break encodeLoop + } + cv = load6432(src, s) + } + + // A 4-byte match has been found. Update recent offsets. + // We'll later see if more than 4 bytes. + offset2 = offset1 + offset1 = s - t + + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + + if debugAsserts && canRepeat && int(offset1) > len(src) { + panic("invalid offset") + } + + // Extend the 4-byte match as long as possible. + l := e.matchlen(s+4, t+4, src) + 4 + + // Extend backwards + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for t > tMin && s > nextEmit && src[t-1] == src[s-1] && l < maxMatchLength { + s-- + t-- + l++ + } + + // Write our sequence + var seq seq + seq.litLen = uint32(s - nextEmit) + seq.matchLen = uint32(l - zstdMinMatch) + if seq.litLen > 0 { + blk.literals = append(blk.literals, src[nextEmit:s]...) + } + seq.offset = uint32(s-t) + 3 + s += l + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + nextEmit = s + if s >= sLimit { + break encodeLoop + } + + // Index match start+1 (long) and start+2 (short) + index0 := s - l + 1 + // Index match end-2 (long) and end-1 (short) + index1 := s - 2 + + cv0 := load6432(src, index0) + cv1 := load6432(src, index1) + te0 := tableEntry{offset: index0 + e.cur, val: uint32(cv0)} + te1 := tableEntry{offset: index1 + e.cur, val: uint32(cv1)} + longHash1 := hashLen(cv0, dFastLongTableBits, dFastLongLen) + longHash2 := hashLen(cv1, dFastLongTableBits, dFastLongLen) + e.longTable[longHash1] = te0 + e.longTable[longHash2] = te1 + e.markLongShardDirty(longHash1) + e.markLongShardDirty(longHash2) + cv0 >>= 8 + cv1 >>= 8 + te0.offset++ + te1.offset++ + te0.val = uint32(cv0) + te1.val = uint32(cv1) + hashVal1 := hashLen(cv0, dFastShortTableBits, dFastShortLen) + hashVal2 := hashLen(cv1, dFastShortTableBits, dFastShortLen) + e.table[hashVal1] = te0 + e.markShardDirty(hashVal1) + e.table[hashVal2] = te1 + e.markShardDirty(hashVal2) + + cv = load6432(src, s) + + if !canRepeat { + continue + } + + // Check offset 2 + for { + o2 := s - offset2 + if load3232(src, o2) != uint32(cv) { + // Do regular search + break + } + + // Store this, since we have it. + nextHashL := hashLen(cv, dFastLongTableBits, dFastLongLen) + nextHashS := hashLen(cv, dFastShortTableBits, dFastShortLen) + + // We have at least 4 byte match. + // No need to check backwards. We come straight from a match + l := 4 + e.matchlen(s+4, o2+4, src) + + entry := tableEntry{offset: s + e.cur, val: uint32(cv)} + e.longTable[nextHashL] = entry + e.markLongShardDirty(nextHashL) + e.table[nextHashS] = entry + e.markShardDirty(nextHashS) + seq.matchLen = uint32(l) - zstdMinMatch + seq.litLen = 0 + + // Since litlen is always 0, this is offset 1. + seq.offset = 1 + s += l + nextEmit = s + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + + // Swap offset 1 and 2. + offset1, offset2 = offset2, offset1 + if s >= sLimit { + // Finished + break encodeLoop + } + cv = load6432(src, s) + } + } + + if int(nextEmit) < len(src) { + blk.literals = append(blk.literals, src[nextEmit:]...) + blk.extraLits = len(src) - int(nextEmit) + } + blk.recentOffsets[0] = uint32(offset1) + blk.recentOffsets[1] = uint32(offset2) + if debugEncoder { + println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) + } + // If we encoded more than 64K mark all dirty. + if len(src) > 64<<10 { + e.markAllShardsDirty() + } +} + +// ResetDict will reset and set a dictionary if not nil +func (e *doubleFastEncoder) Reset(d *dict, singleBlock bool) { + e.fastEncoder.Reset(d, singleBlock) + if d != nil { + panic("doubleFastEncoder: Reset with dict not supported") + } +} + +// ResetDict will reset and set a dictionary if not nil +func (e *doubleFastEncoderDict) Reset(d *dict, singleBlock bool) { + allDirty := e.allDirty + e.fastEncoderDict.Reset(d, singleBlock) + if d == nil { + return + } + + // Init or copy dict table + if len(e.dictLongTable) != len(e.longTable) || d.id != e.lastDictID { + if len(e.dictLongTable) != len(e.longTable) { + e.dictLongTable = make([]tableEntry, len(e.longTable)) + } + if len(d.content) >= 8 { + cv := load6432(d.content, 0) + e.dictLongTable[hashLen(cv, dFastLongTableBits, dFastLongLen)] = tableEntry{ + val: uint32(cv), + offset: e.maxMatchOff, + } + end := int32(len(d.content)) - 8 + e.maxMatchOff + for i := e.maxMatchOff + 1; i < end; i++ { + cv = cv>>8 | (uint64(d.content[i-e.maxMatchOff+7]) << 56) + e.dictLongTable[hashLen(cv, dFastLongTableBits, dFastLongLen)] = tableEntry{ + val: uint32(cv), + offset: i, + } + } + } + e.lastDictID = d.id + allDirty = true + } + // Reset table to initial state + e.cur = e.maxMatchOff + + dirtyShardCnt := 0 + if !allDirty { + for i := range e.longTableShardDirty { + if e.longTableShardDirty[i] { + dirtyShardCnt++ + } + } + } + + if allDirty || dirtyShardCnt > dLongTableShardCnt/2 { + //copy(e.longTable[:], e.dictLongTable) + e.longTable = *(*[dFastLongTableSize]tableEntry)(e.dictLongTable) + for i := range e.longTableShardDirty { + e.longTableShardDirty[i] = false + } + return + } + for i := range e.longTableShardDirty { + if !e.longTableShardDirty[i] { + continue + } + + // copy(e.longTable[i*dLongTableShardSize:(i+1)*dLongTableShardSize], e.dictLongTable[i*dLongTableShardSize:(i+1)*dLongTableShardSize]) + *(*[dLongTableShardSize]tableEntry)(e.longTable[i*dLongTableShardSize:]) = *(*[dLongTableShardSize]tableEntry)(e.dictLongTable[i*dLongTableShardSize:]) + + e.longTableShardDirty[i] = false + } +} + +func (e *doubleFastEncoderDict) markLongShardDirty(entryNum uint32) { + e.longTableShardDirty[entryNum/dLongTableShardSize] = true +} diff --git a/vendor/github.com/klauspost/compress/zstd/enc_fast.go b/vendor/github.com/klauspost/compress/zstd/enc_fast.go new file mode 100644 index 000000000..f45a3da7d --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/enc_fast.go @@ -0,0 +1,891 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "fmt" +) + +const ( + tableBits = 15 // Bits used in the table + tableSize = 1 << tableBits // Size of the table + tableShardCnt = 1 << (tableBits - dictShardBits) // Number of shards in the table + tableShardSize = tableSize / tableShardCnt // Size of an individual shard + tableFastHashLen = 6 + tableMask = tableSize - 1 // Mask for table indices. Redundant, but can eliminate bounds checks. + maxMatchLength = 131074 +) + +type tableEntry struct { + val uint32 + offset int32 +} + +type fastEncoder struct { + fastBase + table [tableSize]tableEntry +} + +type fastEncoderDict struct { + fastEncoder + dictTable []tableEntry + tableShardDirty [tableShardCnt]bool + allDirty bool +} + +// Encode mimmics functionality in zstd_fast.c +func (e *fastEncoder) Encode(blk *blockEnc, src []byte) { + const ( + inputMargin = 8 + minNonLiteralBlockSize = 1 + 1 + inputMargin + ) + + // Protect against e.cur wraparound. + for e.cur >= e.bufferReset-int32(len(e.hist)) { + if len(e.hist) == 0 { + for i := range e.table[:] { + e.table[i] = tableEntry{} + } + e.cur = e.maxMatchOff + break + } + // Shift down everything in the table that isn't already too far away. + minOff := e.cur + int32(len(e.hist)) - e.maxMatchOff + for i := range e.table[:] { + v := e.table[i].offset + if v < minOff { + v = 0 + } else { + v = v - e.cur + e.maxMatchOff + } + e.table[i].offset = v + } + e.cur = e.maxMatchOff + break + } + + s := e.addBlock(src) + blk.size = len(src) + if len(src) < minNonLiteralBlockSize { + blk.extraLits = len(src) + blk.literals = blk.literals[:len(src)] + copy(blk.literals, src) + return + } + + // Override src + src = e.hist + sLimit := int32(len(src)) - inputMargin + // stepSize is the number of bytes to skip on every main loop iteration. + // It should be >= 2. + const stepSize = 2 + + // TEMPLATE + const hashLog = tableBits + // seems global, but would be nice to tweak. + const kSearchStrength = 6 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := s + cv := load6432(src, s) + + // Relative offsets + offset1 := int32(blk.recentOffsets[0]) + offset2 := int32(blk.recentOffsets[1]) + + addLiterals := func(s *seq, until int32) { + if until == nextEmit { + return + } + blk.literals = append(blk.literals, src[nextEmit:until]...) + s.litLen = uint32(until - nextEmit) + } + if debugEncoder { + println("recent offsets:", blk.recentOffsets) + } + +encodeLoop: + for { + // t will contain the match offset when we find one. + // When existing the search loop, we have already checked 4 bytes. + var t int32 + + // We will not use repeat offsets across blocks. + // By not using them for the first 3 matches + canRepeat := len(blk.sequences) > 2 + + for { + if debugAsserts && canRepeat && offset1 == 0 { + panic("offset0 was 0") + } + + nextHash := hashLen(cv, hashLog, tableFastHashLen) + nextHash2 := hashLen(cv>>8, hashLog, tableFastHashLen) + candidate := e.table[nextHash] + candidate2 := e.table[nextHash2] + repIndex := s - offset1 + 2 + + e.table[nextHash] = tableEntry{offset: s + e.cur, val: uint32(cv)} + e.table[nextHash2] = tableEntry{offset: s + e.cur + 1, val: uint32(cv >> 8)} + + if canRepeat && repIndex >= 0 && load3232(src, repIndex) == uint32(cv>>16) { + // Consider history as well. + var seq seq + length := 4 + e.matchlen(s+6, repIndex+4, src) + seq.matchLen = uint32(length - zstdMinMatch) + + // We might be able to match backwards. + // Extend as long as we can. + start := s + 2 + // We end the search early, so we don't risk 0 literals + // and have to do special offset treatment. + startLimit := nextEmit + 1 + + sMin := s - e.maxMatchOff + if sMin < 0 { + sMin = 0 + } + for repIndex > sMin && start > startLimit && src[repIndex-1] == src[start-1] && seq.matchLen < maxMatchLength-zstdMinMatch { + repIndex-- + start-- + seq.matchLen++ + } + addLiterals(&seq, start) + + // rep 0 + seq.offset = 1 + if debugSequences { + println("repeat sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + s += length + 2 + nextEmit = s + if s >= sLimit { + if debugEncoder { + println("repeat ended", s, length) + + } + break encodeLoop + } + cv = load6432(src, s) + continue + } + coffset0 := s - (candidate.offset - e.cur) + coffset1 := s - (candidate2.offset - e.cur) + 1 + if coffset0 < e.maxMatchOff && uint32(cv) == candidate.val { + // found a regular match + t = candidate.offset - e.cur + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + break + } + + if coffset1 < e.maxMatchOff && uint32(cv>>8) == candidate2.val { + // found a regular match + t = candidate2.offset - e.cur + s++ + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugAsserts && t < 0 { + panic("t<0") + } + break + } + s += stepSize + ((s - nextEmit) >> (kSearchStrength - 1)) + if s >= sLimit { + break encodeLoop + } + cv = load6432(src, s) + } + // A 4-byte match has been found. We'll later see if more than 4 bytes. + offset2 = offset1 + offset1 = s - t + + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + + if debugAsserts && canRepeat && int(offset1) > len(src) { + panic("invalid offset") + } + + // Extend the 4-byte match as long as possible. + l := e.matchlen(s+4, t+4, src) + 4 + + // Extend backwards + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for t > tMin && s > nextEmit && src[t-1] == src[s-1] && l < maxMatchLength { + s-- + t-- + l++ + } + + // Write our sequence. + var seq seq + seq.litLen = uint32(s - nextEmit) + seq.matchLen = uint32(l - zstdMinMatch) + if seq.litLen > 0 { + blk.literals = append(blk.literals, src[nextEmit:s]...) + } + // Don't use repeat offsets + seq.offset = uint32(s-t) + 3 + s += l + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + nextEmit = s + if s >= sLimit { + break encodeLoop + } + cv = load6432(src, s) + + // Check offset 2 + if o2 := s - offset2; canRepeat && load3232(src, o2) == uint32(cv) { + // We have at least 4 byte match. + // No need to check backwards. We come straight from a match + l := 4 + e.matchlen(s+4, o2+4, src) + + // Store this, since we have it. + nextHash := hashLen(cv, hashLog, tableFastHashLen) + e.table[nextHash] = tableEntry{offset: s + e.cur, val: uint32(cv)} + seq.matchLen = uint32(l) - zstdMinMatch + seq.litLen = 0 + // Since litlen is always 0, this is offset 1. + seq.offset = 1 + s += l + nextEmit = s + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + + // Swap offset 1 and 2. + offset1, offset2 = offset2, offset1 + if s >= sLimit { + break encodeLoop + } + // Prepare next loop. + cv = load6432(src, s) + } + } + + if int(nextEmit) < len(src) { + blk.literals = append(blk.literals, src[nextEmit:]...) + blk.extraLits = len(src) - int(nextEmit) + } + blk.recentOffsets[0] = uint32(offset1) + blk.recentOffsets[1] = uint32(offset2) + if debugEncoder { + println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) + } +} + +// EncodeNoHist will encode a block with no history and no following blocks. +// Most notable difference is that src will not be copied for history and +// we do not need to check for max match length. +func (e *fastEncoder) EncodeNoHist(blk *blockEnc, src []byte) { + const ( + inputMargin = 8 + minNonLiteralBlockSize = 1 + 1 + inputMargin + ) + if debugEncoder { + if len(src) > maxCompressedBlockSize { + panic("src too big") + } + } + + // Protect against e.cur wraparound. + if e.cur >= e.bufferReset { + for i := range e.table[:] { + e.table[i] = tableEntry{} + } + e.cur = e.maxMatchOff + } + + s := int32(0) + blk.size = len(src) + if len(src) < minNonLiteralBlockSize { + blk.extraLits = len(src) + blk.literals = blk.literals[:len(src)] + copy(blk.literals, src) + return + } + + sLimit := int32(len(src)) - inputMargin + // stepSize is the number of bytes to skip on every main loop iteration. + // It should be >= 2. + const stepSize = 2 + + // TEMPLATE + const hashLog = tableBits + // seems global, but would be nice to tweak. + const kSearchStrength = 6 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := s + cv := load6432(src, s) + + // Relative offsets + offset1 := int32(blk.recentOffsets[0]) + offset2 := int32(blk.recentOffsets[1]) + + addLiterals := func(s *seq, until int32) { + if until == nextEmit { + return + } + blk.literals = append(blk.literals, src[nextEmit:until]...) + s.litLen = uint32(until - nextEmit) + } + if debugEncoder { + println("recent offsets:", blk.recentOffsets) + } + +encodeLoop: + for { + // t will contain the match offset when we find one. + // When existing the search loop, we have already checked 4 bytes. + var t int32 + + // We will not use repeat offsets across blocks. + // By not using them for the first 3 matches + + for { + nextHash := hashLen(cv, hashLog, tableFastHashLen) + nextHash2 := hashLen(cv>>8, hashLog, tableFastHashLen) + candidate := e.table[nextHash] + candidate2 := e.table[nextHash2] + repIndex := s - offset1 + 2 + + e.table[nextHash] = tableEntry{offset: s + e.cur, val: uint32(cv)} + e.table[nextHash2] = tableEntry{offset: s + e.cur + 1, val: uint32(cv >> 8)} + + if len(blk.sequences) > 2 && load3232(src, repIndex) == uint32(cv>>16) { + // Consider history as well. + var seq seq + length := 4 + e.matchlen(s+6, repIndex+4, src) + + seq.matchLen = uint32(length - zstdMinMatch) + + // We might be able to match backwards. + // Extend as long as we can. + start := s + 2 + // We end the search early, so we don't risk 0 literals + // and have to do special offset treatment. + startLimit := nextEmit + 1 + + sMin := s - e.maxMatchOff + if sMin < 0 { + sMin = 0 + } + for repIndex > sMin && start > startLimit && src[repIndex-1] == src[start-1] { + repIndex-- + start-- + seq.matchLen++ + } + addLiterals(&seq, start) + + // rep 0 + seq.offset = 1 + if debugSequences { + println("repeat sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + s += length + 2 + nextEmit = s + if s >= sLimit { + if debugEncoder { + println("repeat ended", s, length) + + } + break encodeLoop + } + cv = load6432(src, s) + continue + } + coffset0 := s - (candidate.offset - e.cur) + coffset1 := s - (candidate2.offset - e.cur) + 1 + if coffset0 < e.maxMatchOff && uint32(cv) == candidate.val { + // found a regular match + t = candidate.offset - e.cur + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugAsserts && t < 0 { + panic(fmt.Sprintf("t (%d) < 0, candidate.offset: %d, e.cur: %d, coffset0: %d, e.maxMatchOff: %d", t, candidate.offset, e.cur, coffset0, e.maxMatchOff)) + } + break + } + + if coffset1 < e.maxMatchOff && uint32(cv>>8) == candidate2.val { + // found a regular match + t = candidate2.offset - e.cur + s++ + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugAsserts && t < 0 { + panic("t<0") + } + break + } + s += stepSize + ((s - nextEmit) >> (kSearchStrength - 1)) + if s >= sLimit { + break encodeLoop + } + cv = load6432(src, s) + } + // A 4-byte match has been found. We'll later see if more than 4 bytes. + offset2 = offset1 + offset1 = s - t + + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + + if debugAsserts && t < 0 { + panic(fmt.Sprintf("t (%d) < 0 ", t)) + } + // Extend the 4-byte match as long as possible. + l := e.matchlen(s+4, t+4, src) + 4 + + // Extend backwards + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for t > tMin && s > nextEmit && src[t-1] == src[s-1] { + s-- + t-- + l++ + } + + // Write our sequence. + var seq seq + seq.litLen = uint32(s - nextEmit) + seq.matchLen = uint32(l - zstdMinMatch) + if seq.litLen > 0 { + blk.literals = append(blk.literals, src[nextEmit:s]...) + } + // Don't use repeat offsets + seq.offset = uint32(s-t) + 3 + s += l + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + nextEmit = s + if s >= sLimit { + break encodeLoop + } + cv = load6432(src, s) + + // Check offset 2 + if o2 := s - offset2; len(blk.sequences) > 2 && load3232(src, o2) == uint32(cv) { + // We have at least 4 byte match. + // No need to check backwards. We come straight from a match + l := 4 + e.matchlen(s+4, o2+4, src) + + // Store this, since we have it. + nextHash := hashLen(cv, hashLog, tableFastHashLen) + e.table[nextHash] = tableEntry{offset: s + e.cur, val: uint32(cv)} + seq.matchLen = uint32(l) - zstdMinMatch + seq.litLen = 0 + // Since litlen is always 0, this is offset 1. + seq.offset = 1 + s += l + nextEmit = s + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + + // Swap offset 1 and 2. + offset1, offset2 = offset2, offset1 + if s >= sLimit { + break encodeLoop + } + // Prepare next loop. + cv = load6432(src, s) + } + } + + if int(nextEmit) < len(src) { + blk.literals = append(blk.literals, src[nextEmit:]...) + blk.extraLits = len(src) - int(nextEmit) + } + if debugEncoder { + println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) + } + // We do not store history, so we must offset e.cur to avoid false matches for next user. + if e.cur < e.bufferReset { + e.cur += int32(len(src)) + } +} + +// Encode will encode the content, with a dictionary if initialized for it. +func (e *fastEncoderDict) Encode(blk *blockEnc, src []byte) { + const ( + inputMargin = 8 + minNonLiteralBlockSize = 1 + 1 + inputMargin + ) + if e.allDirty || len(src) > 32<<10 { + e.fastEncoder.Encode(blk, src) + e.allDirty = true + return + } + // Protect against e.cur wraparound. + for e.cur >= e.bufferReset-int32(len(e.hist)) { + if len(e.hist) == 0 { + e.table = [tableSize]tableEntry{} + e.cur = e.maxMatchOff + break + } + // Shift down everything in the table that isn't already too far away. + minOff := e.cur + int32(len(e.hist)) - e.maxMatchOff + for i := range e.table[:] { + v := e.table[i].offset + if v < minOff { + v = 0 + } else { + v = v - e.cur + e.maxMatchOff + } + e.table[i].offset = v + } + e.cur = e.maxMatchOff + break + } + + s := e.addBlock(src) + blk.size = len(src) + if len(src) < minNonLiteralBlockSize { + blk.extraLits = len(src) + blk.literals = blk.literals[:len(src)] + copy(blk.literals, src) + return + } + + // Override src + src = e.hist + sLimit := int32(len(src)) - inputMargin + // stepSize is the number of bytes to skip on every main loop iteration. + // It should be >= 2. + const stepSize = 2 + + // TEMPLATE + const hashLog = tableBits + // seems global, but would be nice to tweak. + const kSearchStrength = 7 + + // nextEmit is where in src the next emitLiteral should start from. + nextEmit := s + cv := load6432(src, s) + + // Relative offsets + offset1 := int32(blk.recentOffsets[0]) + offset2 := int32(blk.recentOffsets[1]) + + addLiterals := func(s *seq, until int32) { + if until == nextEmit { + return + } + blk.literals = append(blk.literals, src[nextEmit:until]...) + s.litLen = uint32(until - nextEmit) + } + if debugEncoder { + println("recent offsets:", blk.recentOffsets) + } + +encodeLoop: + for { + // t will contain the match offset when we find one. + // When existing the search loop, we have already checked 4 bytes. + var t int32 + + // We will not use repeat offsets across blocks. + // By not using them for the first 3 matches + canRepeat := len(blk.sequences) > 2 + + for { + if debugAsserts && canRepeat && offset1 == 0 { + panic("offset0 was 0") + } + + nextHash := hashLen(cv, hashLog, tableFastHashLen) + nextHash2 := hashLen(cv>>8, hashLog, tableFastHashLen) + candidate := e.table[nextHash] + candidate2 := e.table[nextHash2] + repIndex := s - offset1 + 2 + + e.table[nextHash] = tableEntry{offset: s + e.cur, val: uint32(cv)} + e.markShardDirty(nextHash) + e.table[nextHash2] = tableEntry{offset: s + e.cur + 1, val: uint32(cv >> 8)} + e.markShardDirty(nextHash2) + + if canRepeat && repIndex >= 0 && load3232(src, repIndex) == uint32(cv>>16) { + // Consider history as well. + var seq seq + length := 4 + e.matchlen(s+6, repIndex+4, src) + + seq.matchLen = uint32(length - zstdMinMatch) + + // We might be able to match backwards. + // Extend as long as we can. + start := s + 2 + // We end the search early, so we don't risk 0 literals + // and have to do special offset treatment. + startLimit := nextEmit + 1 + + sMin := s - e.maxMatchOff + if sMin < 0 { + sMin = 0 + } + for repIndex > sMin && start > startLimit && src[repIndex-1] == src[start-1] && seq.matchLen < maxMatchLength-zstdMinMatch { + repIndex-- + start-- + seq.matchLen++ + } + addLiterals(&seq, start) + + // rep 0 + seq.offset = 1 + if debugSequences { + println("repeat sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + s += length + 2 + nextEmit = s + if s >= sLimit { + if debugEncoder { + println("repeat ended", s, length) + + } + break encodeLoop + } + cv = load6432(src, s) + continue + } + coffset0 := s - (candidate.offset - e.cur) + coffset1 := s - (candidate2.offset - e.cur) + 1 + if coffset0 < e.maxMatchOff && uint32(cv) == candidate.val { + // found a regular match + t = candidate.offset - e.cur + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + break + } + + if coffset1 < e.maxMatchOff && uint32(cv>>8) == candidate2.val { + // found a regular match + t = candidate2.offset - e.cur + s++ + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + if debugAsserts && s-t > e.maxMatchOff { + panic("s - t >e.maxMatchOff") + } + if debugAsserts && t < 0 { + panic("t<0") + } + break + } + s += stepSize + ((s - nextEmit) >> (kSearchStrength - 1)) + if s >= sLimit { + break encodeLoop + } + cv = load6432(src, s) + } + // A 4-byte match has been found. We'll later see if more than 4 bytes. + offset2 = offset1 + offset1 = s - t + + if debugAsserts && s <= t { + panic(fmt.Sprintf("s (%d) <= t (%d)", s, t)) + } + + if debugAsserts && canRepeat && int(offset1) > len(src) { + panic("invalid offset") + } + + // Extend the 4-byte match as long as possible. + l := e.matchlen(s+4, t+4, src) + 4 + + // Extend backwards + tMin := s - e.maxMatchOff + if tMin < 0 { + tMin = 0 + } + for t > tMin && s > nextEmit && src[t-1] == src[s-1] && l < maxMatchLength { + s-- + t-- + l++ + } + + // Write our sequence. + var seq seq + seq.litLen = uint32(s - nextEmit) + seq.matchLen = uint32(l - zstdMinMatch) + if seq.litLen > 0 { + blk.literals = append(blk.literals, src[nextEmit:s]...) + } + // Don't use repeat offsets + seq.offset = uint32(s-t) + 3 + s += l + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + nextEmit = s + if s >= sLimit { + break encodeLoop + } + cv = load6432(src, s) + + // Check offset 2 + if o2 := s - offset2; canRepeat && load3232(src, o2) == uint32(cv) { + // We have at least 4 byte match. + // No need to check backwards. We come straight from a match + l := 4 + e.matchlen(s+4, o2+4, src) + + // Store this, since we have it. + nextHash := hashLen(cv, hashLog, tableFastHashLen) + e.table[nextHash] = tableEntry{offset: s + e.cur, val: uint32(cv)} + e.markShardDirty(nextHash) + seq.matchLen = uint32(l) - zstdMinMatch + seq.litLen = 0 + // Since litlen is always 0, this is offset 1. + seq.offset = 1 + s += l + nextEmit = s + if debugSequences { + println("sequence", seq, "next s:", s) + } + blk.sequences = append(blk.sequences, seq) + + // Swap offset 1 and 2. + offset1, offset2 = offset2, offset1 + if s >= sLimit { + break encodeLoop + } + // Prepare next loop. + cv = load6432(src, s) + } + } + + if int(nextEmit) < len(src) { + blk.literals = append(blk.literals, src[nextEmit:]...) + blk.extraLits = len(src) - int(nextEmit) + } + blk.recentOffsets[0] = uint32(offset1) + blk.recentOffsets[1] = uint32(offset2) + if debugEncoder { + println("returning, recent offsets:", blk.recentOffsets, "extra literals:", blk.extraLits) + } +} + +// ResetDict will reset and set a dictionary if not nil +func (e *fastEncoder) Reset(d *dict, singleBlock bool) { + e.resetBase(d, singleBlock) + if d != nil { + panic("fastEncoder: Reset with dict") + } +} + +// ResetDict will reset and set a dictionary if not nil +func (e *fastEncoderDict) Reset(d *dict, singleBlock bool) { + e.resetBase(d, singleBlock) + if d == nil { + return + } + + // Init or copy dict table + if len(e.dictTable) != len(e.table) || d.id != e.lastDictID { + if len(e.dictTable) != len(e.table) { + e.dictTable = make([]tableEntry, len(e.table)) + } + if true { + end := e.maxMatchOff + int32(len(d.content)) - 8 + for i := e.maxMatchOff; i < end; i += 2 { + const hashLog = tableBits + + cv := load6432(d.content, i-e.maxMatchOff) + nextHash := hashLen(cv, hashLog, tableFastHashLen) // 0 -> 6 + nextHash1 := hashLen(cv>>8, hashLog, tableFastHashLen) // 1 -> 7 + e.dictTable[nextHash] = tableEntry{ + val: uint32(cv), + offset: i, + } + e.dictTable[nextHash1] = tableEntry{ + val: uint32(cv >> 8), + offset: i + 1, + } + } + } + e.lastDictID = d.id + e.allDirty = true + } + + e.cur = e.maxMatchOff + dirtyShardCnt := 0 + if !e.allDirty { + for i := range e.tableShardDirty { + if e.tableShardDirty[i] { + dirtyShardCnt++ + } + } + } + + const shardCnt = tableShardCnt + const shardSize = tableShardSize + if e.allDirty || dirtyShardCnt > shardCnt*4/6 { + //copy(e.table[:], e.dictTable) + e.table = *(*[tableSize]tableEntry)(e.dictTable) + for i := range e.tableShardDirty { + e.tableShardDirty[i] = false + } + e.allDirty = false + return + } + for i := range e.tableShardDirty { + if !e.tableShardDirty[i] { + continue + } + + //copy(e.table[i*shardSize:(i+1)*shardSize], e.dictTable[i*shardSize:(i+1)*shardSize]) + *(*[shardSize]tableEntry)(e.table[i*shardSize:]) = *(*[shardSize]tableEntry)(e.dictTable[i*shardSize:]) + e.tableShardDirty[i] = false + } + e.allDirty = false +} + +func (e *fastEncoderDict) markAllShardsDirty() { + e.allDirty = true +} + +func (e *fastEncoderDict) markShardDirty(entryNum uint32) { + e.tableShardDirty[entryNum/tableShardSize] = true +} diff --git a/vendor/github.com/klauspost/compress/zstd/encoder.go b/vendor/github.com/klauspost/compress/zstd/encoder.go new file mode 100644 index 000000000..4de0aed0d --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/encoder.go @@ -0,0 +1,624 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "crypto/rand" + "fmt" + "io" + "math" + rdebug "runtime/debug" + "sync" + + "github.com/klauspost/compress/zstd/internal/xxhash" +) + +// Encoder provides encoding to Zstandard. +// An Encoder can be used for either compressing a stream via the +// io.WriteCloser interface supported by the Encoder or as multiple independent +// tasks via the EncodeAll function. +// Smaller encodes are encouraged to use the EncodeAll function. +// Use NewWriter to create a new instance. +type Encoder struct { + o encoderOptions + encoders chan encoder + state encoderState + init sync.Once +} + +type encoder interface { + Encode(blk *blockEnc, src []byte) + EncodeNoHist(blk *blockEnc, src []byte) + Block() *blockEnc + CRC() *xxhash.Digest + AppendCRC([]byte) []byte + WindowSize(size int64) int32 + UseBlock(*blockEnc) + Reset(d *dict, singleBlock bool) +} + +type encoderState struct { + w io.Writer + filling []byte + current []byte + previous []byte + encoder encoder + writing *blockEnc + err error + writeErr error + nWritten int64 + nInput int64 + frameContentSize int64 + headerWritten bool + eofWritten bool + fullFrameWritten bool + + // This waitgroup indicates an encode is running. + wg sync.WaitGroup + // This waitgroup indicates we have a block encoding/writing. + wWg sync.WaitGroup +} + +// NewWriter will create a new Zstandard encoder. +// If the encoder will be used for encoding blocks a nil writer can be used. +func NewWriter(w io.Writer, opts ...EOption) (*Encoder, error) { + initPredefined() + var e Encoder + e.o.setDefault() + for _, o := range opts { + err := o(&e.o) + if err != nil { + return nil, err + } + } + if w != nil { + e.Reset(w) + } + return &e, nil +} + +func (e *Encoder) initialize() { + if e.o.concurrent == 0 { + e.o.setDefault() + } + e.encoders = make(chan encoder, e.o.concurrent) + for i := 0; i < e.o.concurrent; i++ { + enc := e.o.encoder() + e.encoders <- enc + } +} + +// Reset will re-initialize the writer and new writes will encode to the supplied writer +// as a new, independent stream. +func (e *Encoder) Reset(w io.Writer) { + s := &e.state + s.wg.Wait() + s.wWg.Wait() + if cap(s.filling) == 0 { + s.filling = make([]byte, 0, e.o.blockSize) + } + if e.o.concurrent > 1 { + if cap(s.current) == 0 { + s.current = make([]byte, 0, e.o.blockSize) + } + if cap(s.previous) == 0 { + s.previous = make([]byte, 0, e.o.blockSize) + } + s.current = s.current[:0] + s.previous = s.previous[:0] + if s.writing == nil { + s.writing = &blockEnc{lowMem: e.o.lowMem} + s.writing.init() + } + s.writing.initNewEncode() + } + if s.encoder == nil { + s.encoder = e.o.encoder() + } + s.filling = s.filling[:0] + s.encoder.Reset(e.o.dict, false) + s.headerWritten = false + s.eofWritten = false + s.fullFrameWritten = false + s.w = w + s.err = nil + s.nWritten = 0 + s.nInput = 0 + s.writeErr = nil + s.frameContentSize = 0 +} + +// ResetContentSize will reset and set a content size for the next stream. +// If the bytes written does not match the size given an error will be returned +// when calling Close(). +// This is removed when Reset is called. +// Sizes <= 0 results in no content size set. +func (e *Encoder) ResetContentSize(w io.Writer, size int64) { + e.Reset(w) + if size >= 0 { + e.state.frameContentSize = size + } +} + +// Write data to the encoder. +// Input data will be buffered and as the buffer fills up +// content will be compressed and written to the output. +// When done writing, use Close to flush the remaining output +// and write CRC if requested. +func (e *Encoder) Write(p []byte) (n int, err error) { + s := &e.state + for len(p) > 0 { + if len(p)+len(s.filling) < e.o.blockSize { + if e.o.crc { + _, _ = s.encoder.CRC().Write(p) + } + s.filling = append(s.filling, p...) + return n + len(p), nil + } + add := p + if len(p)+len(s.filling) > e.o.blockSize { + add = add[:e.o.blockSize-len(s.filling)] + } + if e.o.crc { + _, _ = s.encoder.CRC().Write(add) + } + s.filling = append(s.filling, add...) + p = p[len(add):] + n += len(add) + if len(s.filling) < e.o.blockSize { + return n, nil + } + err := e.nextBlock(false) + if err != nil { + return n, err + } + if debugAsserts && len(s.filling) > 0 { + panic(len(s.filling)) + } + } + return n, nil +} + +// nextBlock will synchronize and start compressing input in e.state.filling. +// If an error has occurred during encoding it will be returned. +func (e *Encoder) nextBlock(final bool) error { + s := &e.state + // Wait for current block. + s.wg.Wait() + if s.err != nil { + return s.err + } + if len(s.filling) > e.o.blockSize { + return fmt.Errorf("block > maxStoreBlockSize") + } + if !s.headerWritten { + // If we have a single block encode, do a sync compression. + if final && len(s.filling) == 0 && !e.o.fullZero { + s.headerWritten = true + s.fullFrameWritten = true + s.eofWritten = true + return nil + } + if final && len(s.filling) > 0 { + s.current = e.EncodeAll(s.filling, s.current[:0]) + var n2 int + n2, s.err = s.w.Write(s.current) + if s.err != nil { + return s.err + } + s.nWritten += int64(n2) + s.nInput += int64(len(s.filling)) + s.current = s.current[:0] + s.filling = s.filling[:0] + s.headerWritten = true + s.fullFrameWritten = true + s.eofWritten = true + return nil + } + + var tmp [maxHeaderSize]byte + fh := frameHeader{ + ContentSize: uint64(s.frameContentSize), + WindowSize: uint32(s.encoder.WindowSize(s.frameContentSize)), + SingleSegment: false, + Checksum: e.o.crc, + DictID: e.o.dict.ID(), + } + + dst, err := fh.appendTo(tmp[:0]) + if err != nil { + return err + } + s.headerWritten = true + s.wWg.Wait() + var n2 int + n2, s.err = s.w.Write(dst) + if s.err != nil { + return s.err + } + s.nWritten += int64(n2) + } + if s.eofWritten { + // Ensure we only write it once. + final = false + } + + if len(s.filling) == 0 { + // Final block, but no data. + if final { + enc := s.encoder + blk := enc.Block() + blk.reset(nil) + blk.last = true + blk.encodeRaw(nil) + s.wWg.Wait() + _, s.err = s.w.Write(blk.output) + s.nWritten += int64(len(blk.output)) + s.eofWritten = true + } + return s.err + } + + // SYNC: + if e.o.concurrent == 1 { + src := s.filling + s.nInput += int64(len(s.filling)) + if debugEncoder { + println("Adding sync block,", len(src), "bytes, final:", final) + } + enc := s.encoder + blk := enc.Block() + blk.reset(nil) + enc.Encode(blk, src) + blk.last = final + if final { + s.eofWritten = true + } + + s.err = blk.encode(src, e.o.noEntropy, !e.o.allLitEntropy) + if s.err != nil { + return s.err + } + _, s.err = s.w.Write(blk.output) + s.nWritten += int64(len(blk.output)) + s.filling = s.filling[:0] + return s.err + } + + // Move blocks forward. + s.filling, s.current, s.previous = s.previous[:0], s.filling, s.current + s.nInput += int64(len(s.current)) + s.wg.Add(1) + go func(src []byte) { + if debugEncoder { + println("Adding block,", len(src), "bytes, final:", final) + } + defer func() { + if r := recover(); r != nil { + s.err = fmt.Errorf("panic while encoding: %v", r) + rdebug.PrintStack() + } + s.wg.Done() + }() + enc := s.encoder + blk := enc.Block() + enc.Encode(blk, src) + blk.last = final + if final { + s.eofWritten = true + } + // Wait for pending writes. + s.wWg.Wait() + if s.writeErr != nil { + s.err = s.writeErr + return + } + // Transfer encoders from previous write block. + blk.swapEncoders(s.writing) + // Transfer recent offsets to next. + enc.UseBlock(s.writing) + s.writing = blk + s.wWg.Add(1) + go func() { + defer func() { + if r := recover(); r != nil { + s.writeErr = fmt.Errorf("panic while encoding/writing: %v", r) + rdebug.PrintStack() + } + s.wWg.Done() + }() + s.writeErr = blk.encode(src, e.o.noEntropy, !e.o.allLitEntropy) + if s.writeErr != nil { + return + } + _, s.writeErr = s.w.Write(blk.output) + s.nWritten += int64(len(blk.output)) + }() + }(s.current) + return nil +} + +// ReadFrom reads data from r until EOF or error. +// The return value n is the number of bytes read. +// Any error except io.EOF encountered during the read is also returned. +// +// The Copy function uses ReaderFrom if available. +func (e *Encoder) ReadFrom(r io.Reader) (n int64, err error) { + if debugEncoder { + println("Using ReadFrom") + } + + // Flush any current writes. + if len(e.state.filling) > 0 { + if err := e.nextBlock(false); err != nil { + return 0, err + } + } + e.state.filling = e.state.filling[:e.o.blockSize] + src := e.state.filling + for { + n2, err := r.Read(src) + if e.o.crc { + _, _ = e.state.encoder.CRC().Write(src[:n2]) + } + // src is now the unfilled part... + src = src[n2:] + n += int64(n2) + switch err { + case io.EOF: + e.state.filling = e.state.filling[:len(e.state.filling)-len(src)] + if debugEncoder { + println("ReadFrom: got EOF final block:", len(e.state.filling)) + } + return n, nil + case nil: + default: + if debugEncoder { + println("ReadFrom: got error:", err) + } + e.state.err = err + return n, err + } + if len(src) > 0 { + if debugEncoder { + println("ReadFrom: got space left in source:", len(src)) + } + continue + } + err = e.nextBlock(false) + if err != nil { + return n, err + } + e.state.filling = e.state.filling[:e.o.blockSize] + src = e.state.filling + } +} + +// Flush will send the currently written data to output +// and block until everything has been written. +// This should only be used on rare occasions where pushing the currently queued data is critical. +func (e *Encoder) Flush() error { + s := &e.state + if len(s.filling) > 0 { + err := e.nextBlock(false) + if err != nil { + return err + } + } + s.wg.Wait() + s.wWg.Wait() + if s.err != nil { + return s.err + } + return s.writeErr +} + +// Close will flush the final output and close the stream. +// The function will block until everything has been written. +// The Encoder can still be re-used after calling this. +func (e *Encoder) Close() error { + s := &e.state + if s.encoder == nil { + return nil + } + err := e.nextBlock(true) + if err != nil { + return err + } + if s.frameContentSize > 0 { + if s.nInput != s.frameContentSize { + return fmt.Errorf("frame content size %d given, but %d bytes was written", s.frameContentSize, s.nInput) + } + } + if e.state.fullFrameWritten { + return s.err + } + s.wg.Wait() + s.wWg.Wait() + + if s.err != nil { + return s.err + } + if s.writeErr != nil { + return s.writeErr + } + + // Write CRC + if e.o.crc && s.err == nil { + // heap alloc. + var tmp [4]byte + _, s.err = s.w.Write(s.encoder.AppendCRC(tmp[:0])) + s.nWritten += 4 + } + + // Add padding with content from crypto/rand.Reader + if s.err == nil && e.o.pad > 0 { + add := calcSkippableFrame(s.nWritten, int64(e.o.pad)) + frame, err := skippableFrame(s.filling[:0], add, rand.Reader) + if err != nil { + return err + } + _, s.err = s.w.Write(frame) + } + return s.err +} + +// EncodeAll will encode all input in src and append it to dst. +// This function can be called concurrently, but each call will only run on a single goroutine. +// If empty input is given, nothing is returned, unless WithZeroFrames is specified. +// Encoded blocks can be concatenated and the result will be the combined input stream. +// Data compressed with EncodeAll can be decoded with the Decoder, +// using either a stream or DecodeAll. +func (e *Encoder) EncodeAll(src, dst []byte) []byte { + if len(src) == 0 { + if e.o.fullZero { + // Add frame header. + fh := frameHeader{ + ContentSize: 0, + WindowSize: MinWindowSize, + SingleSegment: true, + // Adding a checksum would be a waste of space. + Checksum: false, + DictID: 0, + } + dst, _ = fh.appendTo(dst) + + // Write raw block as last one only. + var blk blockHeader + blk.setSize(0) + blk.setType(blockTypeRaw) + blk.setLast(true) + dst = blk.appendTo(dst) + } + return dst + } + e.init.Do(e.initialize) + enc := <-e.encoders + defer func() { + // Release encoder reference to last block. + // If a non-single block is needed the encoder will reset again. + e.encoders <- enc + }() + // Use single segments when above minimum window and below window size. + single := len(src) <= e.o.windowSize && len(src) > MinWindowSize + if e.o.single != nil { + single = *e.o.single + } + fh := frameHeader{ + ContentSize: uint64(len(src)), + WindowSize: uint32(enc.WindowSize(int64(len(src)))), + SingleSegment: single, + Checksum: e.o.crc, + DictID: e.o.dict.ID(), + } + + // If less than 1MB, allocate a buffer up front. + if len(dst) == 0 && cap(dst) == 0 && len(src) < 1<<20 && !e.o.lowMem { + dst = make([]byte, 0, len(src)) + } + dst, err := fh.appendTo(dst) + if err != nil { + panic(err) + } + + // If we can do everything in one block, prefer that. + if len(src) <= e.o.blockSize { + enc.Reset(e.o.dict, true) + // Slightly faster with no history and everything in one block. + if e.o.crc { + _, _ = enc.CRC().Write(src) + } + blk := enc.Block() + blk.last = true + if e.o.dict == nil { + enc.EncodeNoHist(blk, src) + } else { + enc.Encode(blk, src) + } + + // If we got the exact same number of literals as input, + // assume the literals cannot be compressed. + oldout := blk.output + // Output directly to dst + blk.output = dst + + err := blk.encode(src, e.o.noEntropy, !e.o.allLitEntropy) + if err != nil { + panic(err) + } + dst = blk.output + blk.output = oldout + } else { + enc.Reset(e.o.dict, false) + blk := enc.Block() + for len(src) > 0 { + todo := src + if len(todo) > e.o.blockSize { + todo = todo[:e.o.blockSize] + } + src = src[len(todo):] + if e.o.crc { + _, _ = enc.CRC().Write(todo) + } + blk.pushOffsets() + enc.Encode(blk, todo) + if len(src) == 0 { + blk.last = true + } + err := blk.encode(todo, e.o.noEntropy, !e.o.allLitEntropy) + if err != nil { + panic(err) + } + dst = append(dst, blk.output...) + blk.reset(nil) + } + } + if e.o.crc { + dst = enc.AppendCRC(dst) + } + // Add padding with content from crypto/rand.Reader + if e.o.pad > 0 { + add := calcSkippableFrame(int64(len(dst)), int64(e.o.pad)) + dst, err = skippableFrame(dst, add, rand.Reader) + if err != nil { + panic(err) + } + } + return dst +} + +// MaxEncodedSize returns the expected maximum +// size of an encoded block or stream. +func (e *Encoder) MaxEncodedSize(size int) int { + frameHeader := 4 + 2 // magic + frame header & window descriptor + if e.o.dict != nil { + frameHeader += 4 + } + // Frame content size: + if size < 256 { + frameHeader++ + } else if size < 65536+256 { + frameHeader += 2 + } else if size < math.MaxInt32 { + frameHeader += 4 + } else { + frameHeader += 8 + } + // Final crc + if e.o.crc { + frameHeader += 4 + } + + // Max overhead is 3 bytes/block. + // There cannot be 0 blocks. + blocks := (size + e.o.blockSize) / e.o.blockSize + + // Combine, add padding. + maxSz := frameHeader + 3*blocks + size + if e.o.pad > 1 { + maxSz += calcSkippableFrame(int64(maxSz), int64(e.o.pad)) + } + return maxSz +} diff --git a/vendor/github.com/klauspost/compress/zstd/encoder_options.go b/vendor/github.com/klauspost/compress/zstd/encoder_options.go new file mode 100644 index 000000000..faaf81921 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/encoder_options.go @@ -0,0 +1,339 @@ +package zstd + +import ( + "errors" + "fmt" + "math" + "math/bits" + "runtime" + "strings" +) + +// EOption is an option for creating a encoder. +type EOption func(*encoderOptions) error + +// options retains accumulated state of multiple options. +type encoderOptions struct { + concurrent int + level EncoderLevel + single *bool + pad int + blockSize int + windowSize int + crc bool + fullZero bool + noEntropy bool + allLitEntropy bool + customWindow bool + customALEntropy bool + customBlockSize bool + lowMem bool + dict *dict +} + +func (o *encoderOptions) setDefault() { + *o = encoderOptions{ + concurrent: runtime.GOMAXPROCS(0), + crc: true, + single: nil, + blockSize: maxCompressedBlockSize, + windowSize: 8 << 20, + level: SpeedDefault, + allLitEntropy: false, + lowMem: false, + } +} + +// encoder returns an encoder with the selected options. +func (o encoderOptions) encoder() encoder { + switch o.level { + case SpeedFastest: + if o.dict != nil { + return &fastEncoderDict{fastEncoder: fastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), bufferReset: math.MaxInt32 - int32(o.windowSize*2), lowMem: o.lowMem}}} + } + return &fastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), bufferReset: math.MaxInt32 - int32(o.windowSize*2), lowMem: o.lowMem}} + + case SpeedDefault: + if o.dict != nil { + return &doubleFastEncoderDict{fastEncoderDict: fastEncoderDict{fastEncoder: fastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), bufferReset: math.MaxInt32 - int32(o.windowSize*2), lowMem: o.lowMem}}}} + } + return &doubleFastEncoder{fastEncoder: fastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), bufferReset: math.MaxInt32 - int32(o.windowSize*2), lowMem: o.lowMem}}} + case SpeedBetterCompression: + if o.dict != nil { + return &betterFastEncoderDict{betterFastEncoder: betterFastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), bufferReset: math.MaxInt32 - int32(o.windowSize*2), lowMem: o.lowMem}}} + } + return &betterFastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), bufferReset: math.MaxInt32 - int32(o.windowSize*2), lowMem: o.lowMem}} + case SpeedBestCompression: + return &bestFastEncoder{fastBase: fastBase{maxMatchOff: int32(o.windowSize), bufferReset: math.MaxInt32 - int32(o.windowSize*2), lowMem: o.lowMem}} + } + panic("unknown compression level") +} + +// WithEncoderCRC will add CRC value to output. +// Output will be 4 bytes larger. +func WithEncoderCRC(b bool) EOption { + return func(o *encoderOptions) error { o.crc = b; return nil } +} + +// WithEncoderConcurrency will set the concurrency, +// meaning the maximum number of encoders to run concurrently. +// The value supplied must be at least 1. +// For streams, setting a value of 1 will disable async compression. +// By default this will be set to GOMAXPROCS. +func WithEncoderConcurrency(n int) EOption { + return func(o *encoderOptions) error { + if n <= 0 { + return fmt.Errorf("concurrency must be at least 1") + } + o.concurrent = n + return nil + } +} + +// WithWindowSize will set the maximum allowed back-reference distance. +// The value must be a power of two between MinWindowSize and MaxWindowSize. +// A larger value will enable better compression but allocate more memory and, +// for above-default values, take considerably longer. +// The default value is determined by the compression level. +func WithWindowSize(n int) EOption { + return func(o *encoderOptions) error { + switch { + case n < MinWindowSize: + return fmt.Errorf("window size must be at least %d", MinWindowSize) + case n > MaxWindowSize: + return fmt.Errorf("window size must be at most %d", MaxWindowSize) + case (n & (n - 1)) != 0: + return errors.New("window size must be a power of 2") + } + + o.windowSize = n + o.customWindow = true + if o.blockSize > o.windowSize { + o.blockSize = o.windowSize + o.customBlockSize = true + } + return nil + } +} + +// WithEncoderPadding will add padding to all output so the size will be a multiple of n. +// This can be used to obfuscate the exact output size or make blocks of a certain size. +// The contents will be a skippable frame, so it will be invisible by the decoder. +// n must be > 0 and <= 1GB, 1<<30 bytes. +// The padded area will be filled with data from crypto/rand.Reader. +// If `EncodeAll` is used with data already in the destination, the total size will be multiple of this. +func WithEncoderPadding(n int) EOption { + return func(o *encoderOptions) error { + if n <= 0 { + return fmt.Errorf("padding must be at least 1") + } + // No need to waste our time. + if n == 1 { + n = 0 + } + if n > 1<<30 { + return fmt.Errorf("padding must less than 1GB (1<<30 bytes) ") + } + o.pad = n + return nil + } +} + +// EncoderLevel predefines encoder compression levels. +// Only use the constants made available, since the actual mapping +// of these values are very likely to change and your compression could change +// unpredictably when upgrading the library. +type EncoderLevel int + +const ( + speedNotSet EncoderLevel = iota + + // SpeedFastest will choose the fastest reasonable compression. + // This is roughly equivalent to the fastest Zstandard mode. + SpeedFastest + + // SpeedDefault is the default "pretty fast" compression option. + // This is roughly equivalent to the default Zstandard mode (level 3). + SpeedDefault + + // SpeedBetterCompression will yield better compression than the default. + // Currently it is about zstd level 7-8 with ~ 2x-3x the default CPU usage. + // By using this, notice that CPU usage may go up in the future. + SpeedBetterCompression + + // SpeedBestCompression will choose the best available compression option. + // This will offer the best compression no matter the CPU cost. + SpeedBestCompression + + // speedLast should be kept as the last actual compression option. + // The is not for external usage, but is used to keep track of the valid options. + speedLast +) + +// EncoderLevelFromString will convert a string representation of an encoding level back +// to a compression level. The compare is not case sensitive. +// If the string wasn't recognized, (false, SpeedDefault) will be returned. +func EncoderLevelFromString(s string) (bool, EncoderLevel) { + for l := speedNotSet + 1; l < speedLast; l++ { + if strings.EqualFold(s, l.String()) { + return true, l + } + } + return false, SpeedDefault +} + +// EncoderLevelFromZstd will return an encoder level that closest matches the compression +// ratio of a specific zstd compression level. +// Many input values will provide the same compression level. +func EncoderLevelFromZstd(level int) EncoderLevel { + switch { + case level < 3: + return SpeedFastest + case level >= 3 && level < 6: + return SpeedDefault + case level >= 6 && level < 10: + return SpeedBetterCompression + default: + return SpeedBestCompression + } +} + +// String provides a string representation of the compression level. +func (e EncoderLevel) String() string { + switch e { + case SpeedFastest: + return "fastest" + case SpeedDefault: + return "default" + case SpeedBetterCompression: + return "better" + case SpeedBestCompression: + return "best" + default: + return "invalid" + } +} + +// WithEncoderLevel specifies a predefined compression level. +func WithEncoderLevel(l EncoderLevel) EOption { + return func(o *encoderOptions) error { + switch { + case l <= speedNotSet || l >= speedLast: + return fmt.Errorf("unknown encoder level") + } + o.level = l + if !o.customWindow { + switch o.level { + case SpeedFastest: + o.windowSize = 4 << 20 + if !o.customBlockSize { + o.blockSize = 1 << 16 + } + case SpeedDefault: + o.windowSize = 8 << 20 + case SpeedBetterCompression: + o.windowSize = 16 << 20 + case SpeedBestCompression: + o.windowSize = 32 << 20 + } + } + if !o.customALEntropy { + o.allLitEntropy = l > SpeedDefault + } + + return nil + } +} + +// WithZeroFrames will encode 0 length input as full frames. +// This can be needed for compatibility with zstandard usage, +// but is not needed for this package. +func WithZeroFrames(b bool) EOption { + return func(o *encoderOptions) error { + o.fullZero = b + return nil + } +} + +// WithAllLitEntropyCompression will apply entropy compression if no matches are found. +// Disabling this will skip incompressible data faster, but in cases with no matches but +// skewed character distribution compression is lost. +// Default value depends on the compression level selected. +func WithAllLitEntropyCompression(b bool) EOption { + return func(o *encoderOptions) error { + o.customALEntropy = true + o.allLitEntropy = b + return nil + } +} + +// WithNoEntropyCompression will always skip entropy compression of literals. +// This can be useful if content has matches, but unlikely to benefit from entropy +// compression. Usually the slight speed improvement is not worth enabling this. +func WithNoEntropyCompression(b bool) EOption { + return func(o *encoderOptions) error { + o.noEntropy = b + return nil + } +} + +// WithSingleSegment will set the "single segment" flag when EncodeAll is used. +// If this flag is set, data must be regenerated within a single continuous memory segment. +// In this case, Window_Descriptor byte is skipped, but Frame_Content_Size is necessarily present. +// As a consequence, the decoder must allocate a memory segment of size equal or larger than size of your content. +// In order to preserve the decoder from unreasonable memory requirements, +// a decoder is allowed to reject a compressed frame which requests a memory size beyond decoder's authorized range. +// For broader compatibility, decoders are recommended to support memory sizes of at least 8 MB. +// This is only a recommendation, each decoder is free to support higher or lower limits, depending on local limitations. +// If this is not specified, block encodes will automatically choose this based on the input size and the window size. +// This setting has no effect on streamed encodes. +func WithSingleSegment(b bool) EOption { + return func(o *encoderOptions) error { + o.single = &b + return nil + } +} + +// WithLowerEncoderMem will trade in some memory cases trade less memory usage for +// slower encoding speed. +// This will not change the window size which is the primary function for reducing +// memory usage. See WithWindowSize. +func WithLowerEncoderMem(b bool) EOption { + return func(o *encoderOptions) error { + o.lowMem = b + return nil + } +} + +// WithEncoderDict allows to register a dictionary that will be used for the encode. +// +// The slice dict must be in the [dictionary format] produced by +// "zstd --train" from the Zstandard reference implementation. +// +// The encoder *may* choose to use no dictionary instead for certain payloads. +// +// [dictionary format]: https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#dictionary-format +func WithEncoderDict(dict []byte) EOption { + return func(o *encoderOptions) error { + d, err := loadDict(dict) + if err != nil { + return err + } + o.dict = d + return nil + } +} + +// WithEncoderDictRaw registers a dictionary that may be used by the encoder. +// +// The slice content may contain arbitrary data. It will be used as an initial +// history. +func WithEncoderDictRaw(id uint32, content []byte) EOption { + return func(o *encoderOptions) error { + if bits.UintSize > 32 && uint(len(content)) > dictMaxLength { + return fmt.Errorf("dictionary of size %d > 2GiB too large", len(content)) + } + o.dict = &dict{id: id, content: content, offsets: [3]int{1, 4, 8}} + return nil + } +} diff --git a/vendor/github.com/klauspost/compress/zstd/framedec.go b/vendor/github.com/klauspost/compress/zstd/framedec.go new file mode 100644 index 000000000..53e160f7e --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/framedec.go @@ -0,0 +1,413 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "encoding/binary" + "encoding/hex" + "errors" + "io" + + "github.com/klauspost/compress/zstd/internal/xxhash" +) + +type frameDec struct { + o decoderOptions + crc *xxhash.Digest + + WindowSize uint64 + + // Frame history passed between blocks + history history + + rawInput byteBuffer + + // Byte buffer that can be reused for small input blocks. + bBuf byteBuf + + FrameContentSize uint64 + + DictionaryID uint32 + HasCheckSum bool + SingleSegment bool +} + +const ( + // MinWindowSize is the minimum Window Size, which is 1 KB. + MinWindowSize = 1 << 10 + + // MaxWindowSize is the maximum encoder window size + // and the default decoder maximum window size. + MaxWindowSize = 1 << 29 +) + +const ( + frameMagic = "\x28\xb5\x2f\xfd" + skippableFrameMagic = "\x2a\x4d\x18" +) + +func newFrameDec(o decoderOptions) *frameDec { + if o.maxWindowSize > o.maxDecodedSize { + o.maxWindowSize = o.maxDecodedSize + } + d := frameDec{ + o: o, + } + return &d +} + +// reset will read the frame header and prepare for block decoding. +// If nothing can be read from the input, io.EOF will be returned. +// Any other error indicated that the stream contained data, but +// there was a problem. +func (d *frameDec) reset(br byteBuffer) error { + d.HasCheckSum = false + d.WindowSize = 0 + var signature [4]byte + for { + var err error + // Check if we can read more... + b, err := br.readSmall(1) + switch err { + case io.EOF, io.ErrUnexpectedEOF: + return io.EOF + case nil: + signature[0] = b[0] + default: + return err + } + // Read the rest, don't allow io.ErrUnexpectedEOF + b, err = br.readSmall(3) + switch err { + case io.EOF: + return io.EOF + case nil: + copy(signature[1:], b) + default: + return err + } + + if string(signature[1:4]) != skippableFrameMagic || signature[0]&0xf0 != 0x50 { + if debugDecoder { + println("Not skippable", hex.EncodeToString(signature[:]), hex.EncodeToString([]byte(skippableFrameMagic))) + } + // Break if not skippable frame. + break + } + // Read size to skip + b, err = br.readSmall(4) + if err != nil { + if debugDecoder { + println("Reading Frame Size", err) + } + return err + } + n := uint32(b[0]) | (uint32(b[1]) << 8) | (uint32(b[2]) << 16) | (uint32(b[3]) << 24) + println("Skipping frame with", n, "bytes.") + err = br.skipN(int64(n)) + if err != nil { + if debugDecoder { + println("Reading discarded frame", err) + } + return err + } + } + if string(signature[:]) != frameMagic { + if debugDecoder { + println("Got magic numbers: ", signature, "want:", []byte(frameMagic)) + } + return ErrMagicMismatch + } + + // Read Frame_Header_Descriptor + fhd, err := br.readByte() + if err != nil { + if debugDecoder { + println("Reading Frame_Header_Descriptor", err) + } + return err + } + d.SingleSegment = fhd&(1<<5) != 0 + + if fhd&(1<<3) != 0 { + return errors.New("reserved bit set on frame header") + } + + // Read Window_Descriptor + // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#window_descriptor + d.WindowSize = 0 + if !d.SingleSegment { + wd, err := br.readByte() + if err != nil { + if debugDecoder { + println("Reading Window_Descriptor", err) + } + return err + } + printf("raw: %x, mantissa: %d, exponent: %d\n", wd, wd&7, wd>>3) + windowLog := 10 + (wd >> 3) + windowBase := uint64(1) << windowLog + windowAdd := (windowBase / 8) * uint64(wd&0x7) + d.WindowSize = windowBase + windowAdd + } + + // Read Dictionary_ID + // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#dictionary_id + d.DictionaryID = 0 + if size := fhd & 3; size != 0 { + if size == 3 { + size = 4 + } + + b, err := br.readSmall(int(size)) + if err != nil { + println("Reading Dictionary_ID", err) + return err + } + var id uint32 + switch len(b) { + case 1: + id = uint32(b[0]) + case 2: + id = uint32(b[0]) | (uint32(b[1]) << 8) + case 4: + id = uint32(b[0]) | (uint32(b[1]) << 8) | (uint32(b[2]) << 16) | (uint32(b[3]) << 24) + } + if debugDecoder { + println("Dict size", size, "ID:", id) + } + d.DictionaryID = id + } + + // Read Frame_Content_Size + // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#frame_content_size + var fcsSize int + v := fhd >> 6 + switch v { + case 0: + if d.SingleSegment { + fcsSize = 1 + } + default: + fcsSize = 1 << v + } + d.FrameContentSize = fcsUnknown + if fcsSize > 0 { + b, err := br.readSmall(fcsSize) + if err != nil { + println("Reading Frame content", err) + return err + } + switch len(b) { + case 1: + d.FrameContentSize = uint64(b[0]) + case 2: + // When FCS_Field_Size is 2, the offset of 256 is added. + d.FrameContentSize = uint64(b[0]) | (uint64(b[1]) << 8) + 256 + case 4: + d.FrameContentSize = uint64(b[0]) | (uint64(b[1]) << 8) | (uint64(b[2]) << 16) | (uint64(b[3]) << 24) + case 8: + d1 := uint32(b[0]) | (uint32(b[1]) << 8) | (uint32(b[2]) << 16) | (uint32(b[3]) << 24) + d2 := uint32(b[4]) | (uint32(b[5]) << 8) | (uint32(b[6]) << 16) | (uint32(b[7]) << 24) + d.FrameContentSize = uint64(d1) | (uint64(d2) << 32) + } + if debugDecoder { + println("Read FCS:", d.FrameContentSize) + } + } + + // Move this to shared. + d.HasCheckSum = fhd&(1<<2) != 0 + if d.HasCheckSum { + if d.crc == nil { + d.crc = xxhash.New() + } + d.crc.Reset() + } + + if d.WindowSize > d.o.maxWindowSize { + if debugDecoder { + printf("window size %d > max %d\n", d.WindowSize, d.o.maxWindowSize) + } + return ErrWindowSizeExceeded + } + + if d.WindowSize == 0 && d.SingleSegment { + // We may not need window in this case. + d.WindowSize = d.FrameContentSize + if d.WindowSize < MinWindowSize { + d.WindowSize = MinWindowSize + } + if d.WindowSize > d.o.maxDecodedSize { + if debugDecoder { + printf("window size %d > max %d\n", d.WindowSize, d.o.maxWindowSize) + } + return ErrDecoderSizeExceeded + } + } + + // The minimum Window_Size is 1 KB. + if d.WindowSize < MinWindowSize { + if debugDecoder { + println("got window size: ", d.WindowSize) + } + return ErrWindowSizeTooSmall + } + d.history.windowSize = int(d.WindowSize) + if !d.o.lowMem || d.history.windowSize < maxBlockSize { + // Alloc 2x window size if not low-mem, or window size below 2MB. + d.history.allocFrameBuffer = d.history.windowSize * 2 + } else { + if d.o.lowMem { + // Alloc with 1MB extra. + d.history.allocFrameBuffer = d.history.windowSize + maxBlockSize/2 + } else { + // Alloc with 2MB extra. + d.history.allocFrameBuffer = d.history.windowSize + maxBlockSize + } + } + + if debugDecoder { + println("Frame: Dict:", d.DictionaryID, "FrameContentSize:", d.FrameContentSize, "singleseg:", d.SingleSegment, "window:", d.WindowSize, "crc:", d.HasCheckSum) + } + + // history contains input - maybe we do something + d.rawInput = br + return nil +} + +// next will start decoding the next block from stream. +func (d *frameDec) next(block *blockDec) error { + if debugDecoder { + println("decoding new block") + } + err := block.reset(d.rawInput, d.WindowSize) + if err != nil { + println("block error:", err) + // Signal the frame decoder we have a problem. + block.sendErr(err) + return err + } + return nil +} + +// checkCRC will check the checksum, assuming the frame has one. +// Will return ErrCRCMismatch if crc check failed, otherwise nil. +func (d *frameDec) checkCRC() error { + // We can overwrite upper tmp now + buf, err := d.rawInput.readSmall(4) + if err != nil { + println("CRC missing?", err) + return err + } + + want := binary.LittleEndian.Uint32(buf[:4]) + got := uint32(d.crc.Sum64()) + + if got != want { + if debugDecoder { + printf("CRC check failed: got %08x, want %08x\n", got, want) + } + return ErrCRCMismatch + } + if debugDecoder { + printf("CRC ok %08x\n", got) + } + return nil +} + +// consumeCRC skips over the checksum, assuming the frame has one. +func (d *frameDec) consumeCRC() error { + _, err := d.rawInput.readSmall(4) + if err != nil { + println("CRC missing?", err) + } + return err +} + +// runDecoder will run the decoder for the remainder of the frame. +func (d *frameDec) runDecoder(dst []byte, dec *blockDec) ([]byte, error) { + saved := d.history.b + + // We use the history for output to avoid copying it. + d.history.b = dst + d.history.ignoreBuffer = len(dst) + // Store input length, so we only check new data. + crcStart := len(dst) + d.history.decoders.maxSyncLen = 0 + if d.o.limitToCap { + d.history.decoders.maxSyncLen = uint64(cap(dst) - len(dst)) + } + if d.FrameContentSize != fcsUnknown { + if !d.o.limitToCap || d.FrameContentSize+uint64(len(dst)) < d.history.decoders.maxSyncLen { + d.history.decoders.maxSyncLen = d.FrameContentSize + uint64(len(dst)) + } + if d.history.decoders.maxSyncLen > d.o.maxDecodedSize { + if debugDecoder { + println("maxSyncLen:", d.history.decoders.maxSyncLen, "> maxDecodedSize:", d.o.maxDecodedSize) + } + return dst, ErrDecoderSizeExceeded + } + if debugDecoder { + println("maxSyncLen:", d.history.decoders.maxSyncLen) + } + if !d.o.limitToCap && uint64(cap(dst)) < d.history.decoders.maxSyncLen { + // Alloc for output + dst2 := make([]byte, len(dst), d.history.decoders.maxSyncLen+compressedBlockOverAlloc) + copy(dst2, dst) + dst = dst2 + } + } + var err error + for { + err = dec.reset(d.rawInput, d.WindowSize) + if err != nil { + break + } + if debugDecoder { + println("next block:", dec) + } + err = dec.decodeBuf(&d.history) + if err != nil { + break + } + if uint64(len(d.history.b)-crcStart) > d.o.maxDecodedSize { + println("runDecoder: maxDecodedSize exceeded", uint64(len(d.history.b)-crcStart), ">", d.o.maxDecodedSize) + err = ErrDecoderSizeExceeded + break + } + if d.o.limitToCap && len(d.history.b) > cap(dst) { + println("runDecoder: cap exceeded", uint64(len(d.history.b)), ">", cap(dst)) + err = ErrDecoderSizeExceeded + break + } + if uint64(len(d.history.b)-crcStart) > d.FrameContentSize { + println("runDecoder: FrameContentSize exceeded", uint64(len(d.history.b)-crcStart), ">", d.FrameContentSize) + err = ErrFrameSizeExceeded + break + } + if dec.Last { + break + } + if debugDecoder { + println("runDecoder: FrameContentSize", uint64(len(d.history.b)-crcStart), "<=", d.FrameContentSize) + } + } + dst = d.history.b + if err == nil { + if d.FrameContentSize != fcsUnknown && uint64(len(d.history.b)-crcStart) != d.FrameContentSize { + err = ErrFrameSizeMismatch + } else if d.HasCheckSum { + if d.o.ignoreChecksum { + err = d.consumeCRC() + } else { + d.crc.Write(dst[crcStart:]) + err = d.checkCRC() + } + } + } + d.history.b = saved + return dst, err +} diff --git a/vendor/github.com/klauspost/compress/zstd/frameenc.go b/vendor/github.com/klauspost/compress/zstd/frameenc.go new file mode 100644 index 000000000..4ef7f5a3e --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/frameenc.go @@ -0,0 +1,137 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "encoding/binary" + "fmt" + "io" + "math" + "math/bits" +) + +type frameHeader struct { + ContentSize uint64 + WindowSize uint32 + SingleSegment bool + Checksum bool + DictID uint32 +} + +const maxHeaderSize = 14 + +func (f frameHeader) appendTo(dst []byte) ([]byte, error) { + dst = append(dst, frameMagic...) + var fhd uint8 + if f.Checksum { + fhd |= 1 << 2 + } + if f.SingleSegment { + fhd |= 1 << 5 + } + + var dictIDContent []byte + if f.DictID > 0 { + var tmp [4]byte + if f.DictID < 256 { + fhd |= 1 + tmp[0] = uint8(f.DictID) + dictIDContent = tmp[:1] + } else if f.DictID < 1<<16 { + fhd |= 2 + binary.LittleEndian.PutUint16(tmp[:2], uint16(f.DictID)) + dictIDContent = tmp[:2] + } else { + fhd |= 3 + binary.LittleEndian.PutUint32(tmp[:4], f.DictID) + dictIDContent = tmp[:4] + } + } + var fcs uint8 + if f.ContentSize >= 256 { + fcs++ + } + if f.ContentSize >= 65536+256 { + fcs++ + } + if f.ContentSize >= 0xffffffff { + fcs++ + } + + fhd |= fcs << 6 + + dst = append(dst, fhd) + if !f.SingleSegment { + const winLogMin = 10 + windowLog := (bits.Len32(f.WindowSize-1) - winLogMin) << 3 + dst = append(dst, uint8(windowLog)) + } + if f.DictID > 0 { + dst = append(dst, dictIDContent...) + } + switch fcs { + case 0: + if f.SingleSegment { + dst = append(dst, uint8(f.ContentSize)) + } + // Unless SingleSegment is set, framessizes < 256 are nto stored. + case 1: + f.ContentSize -= 256 + dst = append(dst, uint8(f.ContentSize), uint8(f.ContentSize>>8)) + case 2: + dst = append(dst, uint8(f.ContentSize), uint8(f.ContentSize>>8), uint8(f.ContentSize>>16), uint8(f.ContentSize>>24)) + case 3: + dst = append(dst, uint8(f.ContentSize), uint8(f.ContentSize>>8), uint8(f.ContentSize>>16), uint8(f.ContentSize>>24), + uint8(f.ContentSize>>32), uint8(f.ContentSize>>40), uint8(f.ContentSize>>48), uint8(f.ContentSize>>56)) + default: + panic("invalid fcs") + } + return dst, nil +} + +const skippableFrameHeader = 4 + 4 + +// calcSkippableFrame will return a total size to be added for written +// to be divisible by multiple. +// The value will always be > skippableFrameHeader. +// The function will panic if written < 0 or wantMultiple <= 0. +func calcSkippableFrame(written, wantMultiple int64) int { + if wantMultiple <= 0 { + panic("wantMultiple <= 0") + } + if written < 0 { + panic("written < 0") + } + leftOver := written % wantMultiple + if leftOver == 0 { + return 0 + } + toAdd := wantMultiple - leftOver + for toAdd < skippableFrameHeader { + toAdd += wantMultiple + } + return int(toAdd) +} + +// skippableFrame will add a skippable frame with a total size of bytes. +// total should be >= skippableFrameHeader and < math.MaxUint32. +func skippableFrame(dst []byte, total int, r io.Reader) ([]byte, error) { + if total == 0 { + return dst, nil + } + if total < skippableFrameHeader { + return dst, fmt.Errorf("requested skippable frame (%d) < 8", total) + } + if int64(total) > math.MaxUint32 { + return dst, fmt.Errorf("requested skippable frame (%d) > max uint32", total) + } + dst = append(dst, 0x50, 0x2a, 0x4d, 0x18) + f := uint32(total - skippableFrameHeader) + dst = append(dst, uint8(f), uint8(f>>8), uint8(f>>16), uint8(f>>24)) + start := len(dst) + dst = append(dst, make([]byte, f)...) + _, err := io.ReadFull(r, dst[start:]) + return dst, err +} diff --git a/vendor/github.com/klauspost/compress/zstd/fse_decoder.go b/vendor/github.com/klauspost/compress/zstd/fse_decoder.go new file mode 100644 index 000000000..2f8860a72 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/fse_decoder.go @@ -0,0 +1,307 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "encoding/binary" + "errors" + "fmt" + "io" +) + +const ( + tablelogAbsoluteMax = 9 +) + +const ( + /*!MEMORY_USAGE : + * Memory usage formula : N->2^N Bytes (examples : 10 -> 1KB; 12 -> 4KB ; 16 -> 64KB; 20 -> 1MB; etc.) + * Increasing memory usage improves compression ratio + * Reduced memory usage can improve speed, due to cache effect + * Recommended max value is 14, for 16KB, which nicely fits into Intel x86 L1 cache */ + maxMemoryUsage = tablelogAbsoluteMax + 2 + + maxTableLog = maxMemoryUsage - 2 + maxTablesize = 1 << maxTableLog + maxTableMask = (1 << maxTableLog) - 1 + minTablelog = 5 + maxSymbolValue = 255 +) + +// fseDecoder provides temporary storage for compression and decompression. +type fseDecoder struct { + dt [maxTablesize]decSymbol // Decompression table. + symbolLen uint16 // Length of active part of the symbol table. + actualTableLog uint8 // Selected tablelog. + maxBits uint8 // Maximum number of additional bits + + // used for table creation to avoid allocations. + stateTable [256]uint16 + norm [maxSymbolValue + 1]int16 + preDefined bool +} + +// tableStep returns the next table index. +func tableStep(tableSize uint32) uint32 { + return (tableSize >> 1) + (tableSize >> 3) + 3 +} + +// readNCount will read the symbol distribution so decoding tables can be constructed. +func (s *fseDecoder) readNCount(b *byteReader, maxSymbol uint16) error { + var ( + charnum uint16 + previous0 bool + ) + if b.remain() < 4 { + return errors.New("input too small") + } + bitStream := b.Uint32NC() + nbBits := uint((bitStream & 0xF) + minTablelog) // extract tableLog + if nbBits > tablelogAbsoluteMax { + println("Invalid tablelog:", nbBits) + return errors.New("tableLog too large") + } + bitStream >>= 4 + bitCount := uint(4) + + s.actualTableLog = uint8(nbBits) + remaining := int32((1 << nbBits) + 1) + threshold := int32(1 << nbBits) + gotTotal := int32(0) + nbBits++ + + for remaining > 1 && charnum <= maxSymbol { + if previous0 { + //println("prev0") + n0 := charnum + for (bitStream & 0xFFFF) == 0xFFFF { + //println("24 x 0") + n0 += 24 + if r := b.remain(); r > 5 { + b.advance(2) + // The check above should make sure we can read 32 bits + bitStream = b.Uint32NC() >> bitCount + } else { + // end of bit stream + bitStream >>= 16 + bitCount += 16 + } + } + //printf("bitstream: %d, 0b%b", bitStream&3, bitStream) + for (bitStream & 3) == 3 { + n0 += 3 + bitStream >>= 2 + bitCount += 2 + } + n0 += uint16(bitStream & 3) + bitCount += 2 + + if n0 > maxSymbolValue { + return errors.New("maxSymbolValue too small") + } + //println("inserting ", n0-charnum, "zeroes from idx", charnum, "ending before", n0) + for charnum < n0 { + s.norm[uint8(charnum)] = 0 + charnum++ + } + + if r := b.remain(); r >= 7 || r-int(bitCount>>3) >= 4 { + b.advance(bitCount >> 3) + bitCount &= 7 + // The check above should make sure we can read 32 bits + bitStream = b.Uint32NC() >> bitCount + } else { + bitStream >>= 2 + } + } + + max := (2*threshold - 1) - remaining + var count int32 + + if int32(bitStream)&(threshold-1) < max { + count = int32(bitStream) & (threshold - 1) + if debugAsserts && nbBits < 1 { + panic("nbBits underflow") + } + bitCount += nbBits - 1 + } else { + count = int32(bitStream) & (2*threshold - 1) + if count >= threshold { + count -= max + } + bitCount += nbBits + } + + // extra accuracy + count-- + if count < 0 { + // -1 means +1 + remaining += count + gotTotal -= count + } else { + remaining -= count + gotTotal += count + } + s.norm[charnum&0xff] = int16(count) + charnum++ + previous0 = count == 0 + for remaining < threshold { + nbBits-- + threshold >>= 1 + } + + if r := b.remain(); r >= 7 || r-int(bitCount>>3) >= 4 { + b.advance(bitCount >> 3) + bitCount &= 7 + // The check above should make sure we can read 32 bits + bitStream = b.Uint32NC() >> (bitCount & 31) + } else { + bitCount -= (uint)(8 * (len(b.b) - 4 - b.off)) + b.off = len(b.b) - 4 + bitStream = b.Uint32() >> (bitCount & 31) + } + } + s.symbolLen = charnum + if s.symbolLen <= 1 { + return fmt.Errorf("symbolLen (%d) too small", s.symbolLen) + } + if s.symbolLen > maxSymbolValue+1 { + return fmt.Errorf("symbolLen (%d) too big", s.symbolLen) + } + if remaining != 1 { + return fmt.Errorf("corruption detected (remaining %d != 1)", remaining) + } + if bitCount > 32 { + return fmt.Errorf("corruption detected (bitCount %d > 32)", bitCount) + } + if gotTotal != 1<> 3) + return s.buildDtable() +} + +func (s *fseDecoder) mustReadFrom(r io.Reader) { + fatalErr := func(err error) { + if err != nil { + panic(err) + } + } + // dt [maxTablesize]decSymbol // Decompression table. + // symbolLen uint16 // Length of active part of the symbol table. + // actualTableLog uint8 // Selected tablelog. + // maxBits uint8 // Maximum number of additional bits + // // used for table creation to avoid allocations. + // stateTable [256]uint16 + // norm [maxSymbolValue + 1]int16 + // preDefined bool + fatalErr(binary.Read(r, binary.LittleEndian, &s.dt)) + fatalErr(binary.Read(r, binary.LittleEndian, &s.symbolLen)) + fatalErr(binary.Read(r, binary.LittleEndian, &s.actualTableLog)) + fatalErr(binary.Read(r, binary.LittleEndian, &s.maxBits)) + fatalErr(binary.Read(r, binary.LittleEndian, &s.stateTable)) + fatalErr(binary.Read(r, binary.LittleEndian, &s.norm)) + fatalErr(binary.Read(r, binary.LittleEndian, &s.preDefined)) +} + +// decSymbol contains information about a state entry, +// Including the state offset base, the output symbol and +// the number of bits to read for the low part of the destination state. +// Using a composite uint64 is faster than a struct with separate members. +type decSymbol uint64 + +func newDecSymbol(nbits, addBits uint8, newState uint16, baseline uint32) decSymbol { + return decSymbol(nbits) | (decSymbol(addBits) << 8) | (decSymbol(newState) << 16) | (decSymbol(baseline) << 32) +} + +func (d decSymbol) nbBits() uint8 { + return uint8(d) +} + +func (d decSymbol) addBits() uint8 { + return uint8(d >> 8) +} + +func (d decSymbol) newState() uint16 { + return uint16(d >> 16) +} + +func (d decSymbol) baselineInt() int { + return int(d >> 32) +} + +func (d *decSymbol) setNBits(nBits uint8) { + const mask = 0xffffffffffffff00 + *d = (*d & mask) | decSymbol(nBits) +} + +func (d *decSymbol) setAddBits(addBits uint8) { + const mask = 0xffffffffffff00ff + *d = (*d & mask) | (decSymbol(addBits) << 8) +} + +func (d *decSymbol) setNewState(state uint16) { + const mask = 0xffffffff0000ffff + *d = (*d & mask) | decSymbol(state)<<16 +} + +func (d *decSymbol) setExt(addBits uint8, baseline uint32) { + const mask = 0xffff00ff + *d = (*d & mask) | (decSymbol(addBits) << 8) | (decSymbol(baseline) << 32) +} + +// decSymbolValue returns the transformed decSymbol for the given symbol. +func decSymbolValue(symb uint8, t []baseOffset) (decSymbol, error) { + if int(symb) >= len(t) { + return 0, fmt.Errorf("rle symbol %d >= max %d", symb, len(t)) + } + lu := t[symb] + return newDecSymbol(0, lu.addBits, 0, lu.baseLine), nil +} + +// setRLE will set the decoder til RLE mode. +func (s *fseDecoder) setRLE(symbol decSymbol) { + s.actualTableLog = 0 + s.maxBits = symbol.addBits() + s.dt[0] = symbol +} + +// transform will transform the decoder table into a table usable for +// decoding without having to apply the transformation while decoding. +// The state will contain the base value and the number of bits to read. +func (s *fseDecoder) transform(t []baseOffset) error { + tableSize := uint16(1 << s.actualTableLog) + s.maxBits = 0 + for i, v := range s.dt[:tableSize] { + add := v.addBits() + if int(add) >= len(t) { + return fmt.Errorf("invalid decoding table entry %d, symbol %d >= max (%d)", i, v.addBits(), len(t)) + } + lu := t[add] + if lu.addBits > s.maxBits { + s.maxBits = lu.addBits + } + v.setExt(lu.addBits, lu.baseLine) + s.dt[i] = v + } + return nil +} + +type fseState struct { + dt []decSymbol + state decSymbol +} + +// Initialize and decodeAsync first state and symbol. +func (s *fseState) init(br *bitReader, tableLog uint8, dt []decSymbol) { + s.dt = dt + br.fill() + s.state = dt[br.getBits(tableLog)] +} + +// final returns the current state symbol without decoding the next. +func (s decSymbol) final() (int, uint8) { + return s.baselineInt(), s.addBits() +} diff --git a/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.go b/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.go new file mode 100644 index 000000000..d04a829b0 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.go @@ -0,0 +1,65 @@ +//go:build amd64 && !appengine && !noasm && gc +// +build amd64,!appengine,!noasm,gc + +package zstd + +import ( + "fmt" +) + +type buildDtableAsmContext struct { + // inputs + stateTable *uint16 + norm *int16 + dt *uint64 + + // outputs --- set by the procedure in the case of error; + // for interpretation please see the error handling part below + errParam1 uint64 + errParam2 uint64 +} + +// buildDtable_asm is an x86 assembly implementation of fseDecoder.buildDtable. +// Function returns non-zero exit code on error. +// +//go:noescape +func buildDtable_asm(s *fseDecoder, ctx *buildDtableAsmContext) int + +// please keep in sync with _generate/gen_fse.go +const ( + errorCorruptedNormalizedCounter = 1 + errorNewStateTooBig = 2 + errorNewStateNoBits = 3 +) + +// buildDtable will build the decoding table. +func (s *fseDecoder) buildDtable() error { + ctx := buildDtableAsmContext{ + stateTable: &s.stateTable[0], + norm: &s.norm[0], + dt: (*uint64)(&s.dt[0]), + } + code := buildDtable_asm(s, &ctx) + + if code != 0 { + switch code { + case errorCorruptedNormalizedCounter: + position := ctx.errParam1 + return fmt.Errorf("corrupted input (position=%d, expected 0)", position) + + case errorNewStateTooBig: + newState := decSymbol(ctx.errParam1) + size := ctx.errParam2 + return fmt.Errorf("newState (%d) outside table size (%d)", newState, size) + + case errorNewStateNoBits: + newState := decSymbol(ctx.errParam1) + oldState := decSymbol(ctx.errParam2) + return fmt.Errorf("newState (%d) == oldState (%d) and no bits", newState, oldState) + + default: + return fmt.Errorf("buildDtable_asm returned unhandled nonzero code = %d", code) + } + } + return nil +} diff --git a/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.s b/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.s new file mode 100644 index 000000000..bcde39869 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/fse_decoder_amd64.s @@ -0,0 +1,126 @@ +// Code generated by command: go run gen_fse.go -out ../fse_decoder_amd64.s -pkg=zstd. DO NOT EDIT. + +//go:build !appengine && !noasm && gc && !noasm + +// func buildDtable_asm(s *fseDecoder, ctx *buildDtableAsmContext) int +TEXT ·buildDtable_asm(SB), $0-24 + MOVQ ctx+8(FP), CX + MOVQ s+0(FP), DI + + // Load values + MOVBQZX 4098(DI), DX + XORQ AX, AX + BTSQ DX, AX + MOVQ (CX), BX + MOVQ 16(CX), SI + LEAQ -1(AX), R8 + MOVQ 8(CX), CX + MOVWQZX 4096(DI), DI + + // End load values + // Init, lay down lowprob symbols + XORQ R9, R9 + JMP init_main_loop_condition + +init_main_loop: + MOVWQSX (CX)(R9*2), R10 + CMPW R10, $-1 + JNE do_not_update_high_threshold + MOVB R9, 1(SI)(R8*8) + DECQ R8 + MOVQ $0x0000000000000001, R10 + +do_not_update_high_threshold: + MOVW R10, (BX)(R9*2) + INCQ R9 + +init_main_loop_condition: + CMPQ R9, DI + JL init_main_loop + + // Spread symbols + // Calculate table step + MOVQ AX, R9 + SHRQ $0x01, R9 + MOVQ AX, R10 + SHRQ $0x03, R10 + LEAQ 3(R9)(R10*1), R9 + + // Fill add bits values + LEAQ -1(AX), R10 + XORQ R11, R11 + XORQ R12, R12 + JMP spread_main_loop_condition + +spread_main_loop: + XORQ R13, R13 + MOVWQSX (CX)(R12*2), R14 + JMP spread_inner_loop_condition + +spread_inner_loop: + MOVB R12, 1(SI)(R11*8) + +adjust_position: + ADDQ R9, R11 + ANDQ R10, R11 + CMPQ R11, R8 + JG adjust_position + INCQ R13 + +spread_inner_loop_condition: + CMPQ R13, R14 + JL spread_inner_loop + INCQ R12 + +spread_main_loop_condition: + CMPQ R12, DI + JL spread_main_loop + TESTQ R11, R11 + JZ spread_check_ok + MOVQ ctx+8(FP), AX + MOVQ R11, 24(AX) + MOVQ $+1, ret+16(FP) + RET + +spread_check_ok: + // Build Decoding table + XORQ DI, DI + +build_table_main_table: + MOVBQZX 1(SI)(DI*8), CX + MOVWQZX (BX)(CX*2), R8 + LEAQ 1(R8), R9 + MOVW R9, (BX)(CX*2) + MOVQ R8, R9 + BSRQ R9, R9 + MOVQ DX, CX + SUBQ R9, CX + SHLQ CL, R8 + SUBQ AX, R8 + MOVB CL, (SI)(DI*8) + MOVW R8, 2(SI)(DI*8) + CMPQ R8, AX + JLE build_table_check1_ok + MOVQ ctx+8(FP), CX + MOVQ R8, 24(CX) + MOVQ AX, 32(CX) + MOVQ $+2, ret+16(FP) + RET + +build_table_check1_ok: + TESTB CL, CL + JNZ build_table_check2_ok + CMPW R8, DI + JNE build_table_check2_ok + MOVQ ctx+8(FP), AX + MOVQ R8, 24(AX) + MOVQ DI, 32(AX) + MOVQ $+3, ret+16(FP) + RET + +build_table_check2_ok: + INCQ DI + CMPQ DI, AX + JL build_table_main_table + MOVQ $+0, ret+16(FP) + RET diff --git a/vendor/github.com/klauspost/compress/zstd/fse_decoder_generic.go b/vendor/github.com/klauspost/compress/zstd/fse_decoder_generic.go new file mode 100644 index 000000000..332e51fe4 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/fse_decoder_generic.go @@ -0,0 +1,72 @@ +//go:build !amd64 || appengine || !gc || noasm +// +build !amd64 appengine !gc noasm + +package zstd + +import ( + "errors" + "fmt" +) + +// buildDtable will build the decoding table. +func (s *fseDecoder) buildDtable() error { + tableSize := uint32(1 << s.actualTableLog) + highThreshold := tableSize - 1 + symbolNext := s.stateTable[:256] + + // Init, lay down lowprob symbols + { + for i, v := range s.norm[:s.symbolLen] { + if v == -1 { + s.dt[highThreshold].setAddBits(uint8(i)) + highThreshold-- + symbolNext[i] = 1 + } else { + symbolNext[i] = uint16(v) + } + } + } + + // Spread symbols + { + tableMask := tableSize - 1 + step := tableStep(tableSize) + position := uint32(0) + for ss, v := range s.norm[:s.symbolLen] { + for i := 0; i < int(v); i++ { + s.dt[position].setAddBits(uint8(ss)) + position = (position + step) & tableMask + for position > highThreshold { + // lowprob area + position = (position + step) & tableMask + } + } + } + if position != 0 { + // position must reach all cells once, otherwise normalizedCounter is incorrect + return errors.New("corrupted input (position != 0)") + } + } + + // Build Decoding table + { + tableSize := uint16(1 << s.actualTableLog) + for u, v := range s.dt[:tableSize] { + symbol := v.addBits() + nextState := symbolNext[symbol] + symbolNext[symbol] = nextState + 1 + nBits := s.actualTableLog - byte(highBits(uint32(nextState))) + s.dt[u&maxTableMask].setNBits(nBits) + newState := (nextState << nBits) - tableSize + if newState > tableSize { + return fmt.Errorf("newState (%d) outside table size (%d)", newState, tableSize) + } + if newState == uint16(u) && nBits == 0 { + // Seems weird that this is possible with nbits > 0. + return fmt.Errorf("newState (%d) == oldState (%d) and no bits", newState, u) + } + s.dt[u&maxTableMask].setNewState(newState) + } + } + return nil +} diff --git a/vendor/github.com/klauspost/compress/zstd/fse_encoder.go b/vendor/github.com/klauspost/compress/zstd/fse_encoder.go new file mode 100644 index 000000000..ab26326a8 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/fse_encoder.go @@ -0,0 +1,701 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "errors" + "fmt" + "math" +) + +const ( + // For encoding we only support up to + maxEncTableLog = 8 + maxEncTablesize = 1 << maxTableLog + maxEncTableMask = (1 << maxTableLog) - 1 + minEncTablelog = 5 + maxEncSymbolValue = maxMatchLengthSymbol +) + +// Scratch provides temporary storage for compression and decompression. +type fseEncoder struct { + symbolLen uint16 // Length of active part of the symbol table. + actualTableLog uint8 // Selected tablelog. + ct cTable // Compression tables. + maxCount int // count of the most probable symbol + zeroBits bool // no bits has prob > 50%. + clearCount bool // clear count + useRLE bool // This encoder is for RLE + preDefined bool // This encoder is predefined. + reUsed bool // Set to know when the encoder has been reused. + rleVal uint8 // RLE Symbol + maxBits uint8 // Maximum output bits after transform. + + // TODO: Technically zstd should be fine with 64 bytes. + count [256]uint32 + norm [256]int16 +} + +// cTable contains tables used for compression. +type cTable struct { + tableSymbol []byte + stateTable []uint16 + symbolTT []symbolTransform +} + +// symbolTransform contains the state transform for a symbol. +type symbolTransform struct { + deltaNbBits uint32 + deltaFindState int16 + outBits uint8 +} + +// String prints values as a human readable string. +func (s symbolTransform) String() string { + return fmt.Sprintf("{deltabits: %08x, findstate:%d outbits:%d}", s.deltaNbBits, s.deltaFindState, s.outBits) +} + +// Histogram allows to populate the histogram and skip that step in the compression, +// It otherwise allows to inspect the histogram when compression is done. +// To indicate that you have populated the histogram call HistogramFinished +// with the value of the highest populated symbol, as well as the number of entries +// in the most populated entry. These are accepted at face value. +func (s *fseEncoder) Histogram() *[256]uint32 { + return &s.count +} + +// HistogramFinished can be called to indicate that the histogram has been populated. +// maxSymbol is the index of the highest set symbol of the next data segment. +// maxCount is the number of entries in the most populated entry. +// These are accepted at face value. +func (s *fseEncoder) HistogramFinished(maxSymbol uint8, maxCount int) { + s.maxCount = maxCount + s.symbolLen = uint16(maxSymbol) + 1 + s.clearCount = maxCount != 0 +} + +// allocCtable will allocate tables needed for compression. +// If existing tables a re big enough, they are simply re-used. +func (s *fseEncoder) allocCtable() { + tableSize := 1 << s.actualTableLog + // get tableSymbol that is big enough. + if cap(s.ct.tableSymbol) < tableSize { + s.ct.tableSymbol = make([]byte, tableSize) + } + s.ct.tableSymbol = s.ct.tableSymbol[:tableSize] + + ctSize := tableSize + if cap(s.ct.stateTable) < ctSize { + s.ct.stateTable = make([]uint16, ctSize) + } + s.ct.stateTable = s.ct.stateTable[:ctSize] + + if cap(s.ct.symbolTT) < 256 { + s.ct.symbolTT = make([]symbolTransform, 256) + } + s.ct.symbolTT = s.ct.symbolTT[:256] +} + +// buildCTable will populate the compression table so it is ready to be used. +func (s *fseEncoder) buildCTable() error { + tableSize := uint32(1 << s.actualTableLog) + highThreshold := tableSize - 1 + var cumul [256]int16 + + s.allocCtable() + tableSymbol := s.ct.tableSymbol[:tableSize] + // symbol start positions + { + cumul[0] = 0 + for ui, v := range s.norm[:s.symbolLen-1] { + u := byte(ui) // one less than reference + if v == -1 { + // Low proba symbol + cumul[u+1] = cumul[u] + 1 + tableSymbol[highThreshold] = u + highThreshold-- + } else { + cumul[u+1] = cumul[u] + v + } + } + // Encode last symbol separately to avoid overflowing u + u := int(s.symbolLen - 1) + v := s.norm[s.symbolLen-1] + if v == -1 { + // Low proba symbol + cumul[u+1] = cumul[u] + 1 + tableSymbol[highThreshold] = byte(u) + highThreshold-- + } else { + cumul[u+1] = cumul[u] + v + } + if uint32(cumul[s.symbolLen]) != tableSize { + return fmt.Errorf("internal error: expected cumul[s.symbolLen] (%d) == tableSize (%d)", cumul[s.symbolLen], tableSize) + } + cumul[s.symbolLen] = int16(tableSize) + 1 + } + // Spread symbols + s.zeroBits = false + { + step := tableStep(tableSize) + tableMask := tableSize - 1 + var position uint32 + // if any symbol > largeLimit, we may have 0 bits output. + largeLimit := int16(1 << (s.actualTableLog - 1)) + for ui, v := range s.norm[:s.symbolLen] { + symbol := byte(ui) + if v > largeLimit { + s.zeroBits = true + } + for nbOccurrences := int16(0); nbOccurrences < v; nbOccurrences++ { + tableSymbol[position] = symbol + position = (position + step) & tableMask + for position > highThreshold { + position = (position + step) & tableMask + } /* Low proba area */ + } + } + + // Check if we have gone through all positions + if position != 0 { + return errors.New("position!=0") + } + } + + // Build table + table := s.ct.stateTable + { + tsi := int(tableSize) + for u, v := range tableSymbol { + // TableU16 : sorted by symbol order; gives next state value + table[cumul[v]] = uint16(tsi + u) + cumul[v]++ + } + } + + // Build Symbol Transformation Table + { + total := int16(0) + symbolTT := s.ct.symbolTT[:s.symbolLen] + tableLog := s.actualTableLog + tl := (uint32(tableLog) << 16) - (1 << tableLog) + for i, v := range s.norm[:s.symbolLen] { + switch v { + case 0: + case -1, 1: + symbolTT[i].deltaNbBits = tl + symbolTT[i].deltaFindState = total - 1 + total++ + default: + maxBitsOut := uint32(tableLog) - highBit(uint32(v-1)) + minStatePlus := uint32(v) << maxBitsOut + symbolTT[i].deltaNbBits = (maxBitsOut << 16) - minStatePlus + symbolTT[i].deltaFindState = total - v + total += v + } + } + if total != int16(tableSize) { + return fmt.Errorf("total mismatch %d (got) != %d (want)", total, tableSize) + } + } + return nil +} + +var rtbTable = [...]uint32{0, 473195, 504333, 520860, 550000, 700000, 750000, 830000} + +func (s *fseEncoder) setRLE(val byte) { + s.allocCtable() + s.actualTableLog = 0 + s.ct.stateTable = s.ct.stateTable[:1] + s.ct.symbolTT[val] = symbolTransform{ + deltaFindState: 0, + deltaNbBits: 0, + } + if debugEncoder { + println("setRLE: val", val, "symbolTT", s.ct.symbolTT[val]) + } + s.rleVal = val + s.useRLE = true +} + +// setBits will set output bits for the transform. +// if nil is provided, the number of bits is equal to the index. +func (s *fseEncoder) setBits(transform []byte) { + if s.reUsed || s.preDefined { + return + } + if s.useRLE { + if transform == nil { + s.ct.symbolTT[s.rleVal].outBits = s.rleVal + s.maxBits = s.rleVal + return + } + s.maxBits = transform[s.rleVal] + s.ct.symbolTT[s.rleVal].outBits = s.maxBits + return + } + if transform == nil { + for i := range s.ct.symbolTT[:s.symbolLen] { + s.ct.symbolTT[i].outBits = uint8(i) + } + s.maxBits = uint8(s.symbolLen - 1) + return + } + s.maxBits = 0 + for i, v := range transform[:s.symbolLen] { + s.ct.symbolTT[i].outBits = v + if v > s.maxBits { + // We could assume bits always going up, but we play safe. + s.maxBits = v + } + } +} + +// normalizeCount will normalize the count of the symbols so +// the total is equal to the table size. +// If successful, compression tables will also be made ready. +func (s *fseEncoder) normalizeCount(length int) error { + if s.reUsed { + return nil + } + s.optimalTableLog(length) + var ( + tableLog = s.actualTableLog + scale = 62 - uint64(tableLog) + step = (1 << 62) / uint64(length) + vStep = uint64(1) << (scale - 20) + stillToDistribute = int16(1 << tableLog) + largest int + largestP int16 + lowThreshold = (uint32)(length >> tableLog) + ) + if s.maxCount == length { + s.useRLE = true + return nil + } + s.useRLE = false + for i, cnt := range s.count[:s.symbolLen] { + // already handled + // if (count[s] == s.length) return 0; /* rle special case */ + + if cnt == 0 { + s.norm[i] = 0 + continue + } + if cnt <= lowThreshold { + s.norm[i] = -1 + stillToDistribute-- + } else { + proba := (int16)((uint64(cnt) * step) >> scale) + if proba < 8 { + restToBeat := vStep * uint64(rtbTable[proba]) + v := uint64(cnt)*step - (uint64(proba) << scale) + if v > restToBeat { + proba++ + } + } + if proba > largestP { + largestP = proba + largest = i + } + s.norm[i] = proba + stillToDistribute -= proba + } + } + + if -stillToDistribute >= (s.norm[largest] >> 1) { + // corner case, need another normalization method + err := s.normalizeCount2(length) + if err != nil { + return err + } + if debugAsserts { + err = s.validateNorm() + if err != nil { + return err + } + } + return s.buildCTable() + } + s.norm[largest] += stillToDistribute + if debugAsserts { + err := s.validateNorm() + if err != nil { + return err + } + } + return s.buildCTable() +} + +// Secondary normalization method. +// To be used when primary method fails. +func (s *fseEncoder) normalizeCount2(length int) error { + const notYetAssigned = -2 + var ( + distributed uint32 + total = uint32(length) + tableLog = s.actualTableLog + lowThreshold = total >> tableLog + lowOne = (total * 3) >> (tableLog + 1) + ) + for i, cnt := range s.count[:s.symbolLen] { + if cnt == 0 { + s.norm[i] = 0 + continue + } + if cnt <= lowThreshold { + s.norm[i] = -1 + distributed++ + total -= cnt + continue + } + if cnt <= lowOne { + s.norm[i] = 1 + distributed++ + total -= cnt + continue + } + s.norm[i] = notYetAssigned + } + toDistribute := (1 << tableLog) - distributed + + if (total / toDistribute) > lowOne { + // risk of rounding to zero + lowOne = (total * 3) / (toDistribute * 2) + for i, cnt := range s.count[:s.symbolLen] { + if (s.norm[i] == notYetAssigned) && (cnt <= lowOne) { + s.norm[i] = 1 + distributed++ + total -= cnt + continue + } + } + toDistribute = (1 << tableLog) - distributed + } + if distributed == uint32(s.symbolLen)+1 { + // all values are pretty poor; + // probably incompressible data (should have already been detected); + // find max, then give all remaining points to max + var maxV int + var maxC uint32 + for i, cnt := range s.count[:s.symbolLen] { + if cnt > maxC { + maxV = i + maxC = cnt + } + } + s.norm[maxV] += int16(toDistribute) + return nil + } + + if total == 0 { + // all of the symbols were low enough for the lowOne or lowThreshold + for i := uint32(0); toDistribute > 0; i = (i + 1) % (uint32(s.symbolLen)) { + if s.norm[i] > 0 { + toDistribute-- + s.norm[i]++ + } + } + return nil + } + + var ( + vStepLog = 62 - uint64(tableLog) + mid = uint64((1 << (vStepLog - 1)) - 1) + rStep = (((1 << vStepLog) * uint64(toDistribute)) + mid) / uint64(total) // scale on remaining + tmpTotal = mid + ) + for i, cnt := range s.count[:s.symbolLen] { + if s.norm[i] == notYetAssigned { + var ( + end = tmpTotal + uint64(cnt)*rStep + sStart = uint32(tmpTotal >> vStepLog) + sEnd = uint32(end >> vStepLog) + weight = sEnd - sStart + ) + if weight < 1 { + return errors.New("weight < 1") + } + s.norm[i] = int16(weight) + tmpTotal = end + } + } + return nil +} + +// optimalTableLog calculates and sets the optimal tableLog in s.actualTableLog +func (s *fseEncoder) optimalTableLog(length int) { + tableLog := uint8(maxEncTableLog) + minBitsSrc := highBit(uint32(length)) + 1 + minBitsSymbols := highBit(uint32(s.symbolLen-1)) + 2 + minBits := uint8(minBitsSymbols) + if minBitsSrc < minBitsSymbols { + minBits = uint8(minBitsSrc) + } + + maxBitsSrc := uint8(highBit(uint32(length-1))) - 2 + if maxBitsSrc < tableLog { + // Accuracy can be reduced + tableLog = maxBitsSrc + } + if minBits > tableLog { + tableLog = minBits + } + // Need a minimum to safely represent all symbol values + if tableLog < minEncTablelog { + tableLog = minEncTablelog + } + if tableLog > maxEncTableLog { + tableLog = maxEncTableLog + } + s.actualTableLog = tableLog +} + +// validateNorm validates the normalized histogram table. +func (s *fseEncoder) validateNorm() (err error) { + var total int + for _, v := range s.norm[:s.symbolLen] { + if v >= 0 { + total += int(v) + } else { + total -= int(v) + } + } + defer func() { + if err == nil { + return + } + fmt.Printf("selected TableLog: %d, Symbol length: %d\n", s.actualTableLog, s.symbolLen) + for i, v := range s.norm[:s.symbolLen] { + fmt.Printf("%3d: %5d -> %4d \n", i, s.count[i], v) + } + }() + if total != (1 << s.actualTableLog) { + return fmt.Errorf("warning: Total == %d != %d", total, 1<> 3) + 3 + 2 + + // Write Table Size + bitStream = uint32(tableLog - minEncTablelog) + bitCount = uint(4) + remaining = int16(tableSize + 1) /* +1 for extra accuracy */ + threshold = int16(tableSize) + nbBits = uint(tableLog + 1) + outP = len(out) + ) + if cap(out) < outP+maxHeaderSize { + out = append(out, make([]byte, maxHeaderSize*3)...) + out = out[:len(out)-maxHeaderSize*3] + } + out = out[:outP+maxHeaderSize] + + // stops at 1 + for remaining > 1 { + if previous0 { + start := charnum + for s.norm[charnum] == 0 { + charnum++ + } + for charnum >= start+24 { + start += 24 + bitStream += uint32(0xFFFF) << bitCount + out[outP] = byte(bitStream) + out[outP+1] = byte(bitStream >> 8) + outP += 2 + bitStream >>= 16 + } + for charnum >= start+3 { + start += 3 + bitStream += 3 << bitCount + bitCount += 2 + } + bitStream += uint32(charnum-start) << bitCount + bitCount += 2 + if bitCount > 16 { + out[outP] = byte(bitStream) + out[outP+1] = byte(bitStream >> 8) + outP += 2 + bitStream >>= 16 + bitCount -= 16 + } + } + + count := s.norm[charnum] + charnum++ + max := (2*threshold - 1) - remaining + if count < 0 { + remaining += count + } else { + remaining -= count + } + count++ // +1 for extra accuracy + if count >= threshold { + count += max // [0..max[ [max..threshold[ (...) [threshold+max 2*threshold[ + } + bitStream += uint32(count) << bitCount + bitCount += nbBits + if count < max { + bitCount-- + } + + previous0 = count == 1 + if remaining < 1 { + return nil, errors.New("internal error: remaining < 1") + } + for remaining < threshold { + nbBits-- + threshold >>= 1 + } + + if bitCount > 16 { + out[outP] = byte(bitStream) + out[outP+1] = byte(bitStream >> 8) + outP += 2 + bitStream >>= 16 + bitCount -= 16 + } + } + + if outP+2 > len(out) { + return nil, fmt.Errorf("internal error: %d > %d, maxheader: %d, sl: %d, tl: %d, normcount: %v", outP+2, len(out), maxHeaderSize, s.symbolLen, int(tableLog), s.norm[:s.symbolLen]) + } + out[outP] = byte(bitStream) + out[outP+1] = byte(bitStream >> 8) + outP += int((bitCount + 7) / 8) + + if charnum > s.symbolLen { + return nil, errors.New("internal error: charnum > s.symbolLen") + } + return out[:outP], nil +} + +// Approximate symbol cost, as fractional value, using fixed-point format (accuracyLog fractional bits) +// note 1 : assume symbolValue is valid (<= maxSymbolValue) +// note 2 : if freq[symbolValue]==0, @return a fake cost of tableLog+1 bits * +func (s *fseEncoder) bitCost(symbolValue uint8, accuracyLog uint32) uint32 { + minNbBits := s.ct.symbolTT[symbolValue].deltaNbBits >> 16 + threshold := (minNbBits + 1) << 16 + if debugAsserts { + if !(s.actualTableLog < 16) { + panic("!s.actualTableLog < 16") + } + // ensure enough room for renormalization double shift + if !(uint8(accuracyLog) < 31-s.actualTableLog) { + panic("!uint8(accuracyLog) < 31-s.actualTableLog") + } + } + tableSize := uint32(1) << s.actualTableLog + deltaFromThreshold := threshold - (s.ct.symbolTT[symbolValue].deltaNbBits + tableSize) + // linear interpolation (very approximate) + normalizedDeltaFromThreshold := (deltaFromThreshold << accuracyLog) >> s.actualTableLog + bitMultiplier := uint32(1) << accuracyLog + if debugAsserts { + if s.ct.symbolTT[symbolValue].deltaNbBits+tableSize > threshold { + panic("s.ct.symbolTT[symbolValue].deltaNbBits+tableSize > threshold") + } + if normalizedDeltaFromThreshold > bitMultiplier { + panic("normalizedDeltaFromThreshold > bitMultiplier") + } + } + return (minNbBits+1)*bitMultiplier - normalizedDeltaFromThreshold +} + +// Returns the cost in bits of encoding the distribution in count using ctable. +// Histogram should only be up to the last non-zero symbol. +// Returns an -1 if ctable cannot represent all the symbols in count. +func (s *fseEncoder) approxSize(hist []uint32) uint32 { + if int(s.symbolLen) < len(hist) { + // More symbols than we have. + return math.MaxUint32 + } + if s.useRLE { + // We will never reuse RLE encoders. + return math.MaxUint32 + } + const kAccuracyLog = 8 + badCost := (uint32(s.actualTableLog) + 1) << kAccuracyLog + var cost uint32 + for i, v := range hist { + if v == 0 { + continue + } + if s.norm[i] == 0 { + return math.MaxUint32 + } + bitCost := s.bitCost(uint8(i), kAccuracyLog) + if bitCost > badCost { + return math.MaxUint32 + } + cost += v * bitCost + } + return cost >> kAccuracyLog +} + +// maxHeaderSize returns the maximum header size in bits. +// This is not exact size, but we want a penalty for new tables anyway. +func (s *fseEncoder) maxHeaderSize() uint32 { + if s.preDefined { + return 0 + } + if s.useRLE { + return 8 + } + return (((uint32(s.symbolLen) * uint32(s.actualTableLog)) >> 3) + 3) * 8 +} + +// cState contains the compression state of a stream. +type cState struct { + bw *bitWriter + stateTable []uint16 + state uint16 +} + +// init will initialize the compression state to the first symbol of the stream. +func (c *cState) init(bw *bitWriter, ct *cTable, first symbolTransform) { + c.bw = bw + c.stateTable = ct.stateTable + if len(c.stateTable) == 1 { + // RLE + c.stateTable[0] = uint16(0) + c.state = 0 + return + } + nbBitsOut := (first.deltaNbBits + (1 << 15)) >> 16 + im := int32((nbBitsOut << 16) - first.deltaNbBits) + lu := (im >> nbBitsOut) + int32(first.deltaFindState) + c.state = c.stateTable[lu] +} + +// flush will write the tablelog to the output and flush the remaining full bytes. +func (c *cState) flush(tableLog uint8) { + c.bw.flush32() + c.bw.addBits16NC(c.state, tableLog) +} diff --git a/vendor/github.com/klauspost/compress/zstd/fse_predefined.go b/vendor/github.com/klauspost/compress/zstd/fse_predefined.go new file mode 100644 index 000000000..474cb77d2 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/fse_predefined.go @@ -0,0 +1,158 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "fmt" + "math" + "sync" +) + +var ( + // fsePredef are the predefined fse tables as defined here: + // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#default-distributions + // These values are already transformed. + fsePredef [3]fseDecoder + + // fsePredefEnc are the predefined encoder based on fse tables as defined here: + // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#default-distributions + // These values are already transformed. + fsePredefEnc [3]fseEncoder + + // symbolTableX contain the transformations needed for each type as defined in + // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#the-codes-for-literals-lengths-match-lengths-and-offsets + symbolTableX [3][]baseOffset + + // maxTableSymbol is the biggest supported symbol for each table type + // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#the-codes-for-literals-lengths-match-lengths-and-offsets + maxTableSymbol = [3]uint8{tableLiteralLengths: maxLiteralLengthSymbol, tableOffsets: maxOffsetLengthSymbol, tableMatchLengths: maxMatchLengthSymbol} + + // bitTables is the bits table for each table. + bitTables = [3][]byte{tableLiteralLengths: llBitsTable[:], tableOffsets: nil, tableMatchLengths: mlBitsTable[:]} +) + +type tableIndex uint8 + +const ( + // indexes for fsePredef and symbolTableX + tableLiteralLengths tableIndex = 0 + tableOffsets tableIndex = 1 + tableMatchLengths tableIndex = 2 + + maxLiteralLengthSymbol = 35 + maxOffsetLengthSymbol = 30 + maxMatchLengthSymbol = 52 +) + +// baseOffset is used for calculating transformations. +type baseOffset struct { + baseLine uint32 + addBits uint8 +} + +// fillBase will precalculate base offsets with the given bit distributions. +func fillBase(dst []baseOffset, base uint32, bits ...uint8) { + if len(bits) != len(dst) { + panic(fmt.Sprintf("len(dst) (%d) != len(bits) (%d)", len(dst), len(bits))) + } + for i, bit := range bits { + if base > math.MaxInt32 { + panic("invalid decoding table, base overflows int32") + } + + dst[i] = baseOffset{ + baseLine: base, + addBits: bit, + } + base += 1 << bit + } +} + +var predef sync.Once + +func initPredefined() { + predef.Do(func() { + // Literals length codes + tmp := make([]baseOffset, 36) + for i := range tmp[:16] { + tmp[i] = baseOffset{ + baseLine: uint32(i), + addBits: 0, + } + } + fillBase(tmp[16:], 16, 1, 1, 1, 1, 2, 2, 3, 3, 4, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16) + symbolTableX[tableLiteralLengths] = tmp + + // Match length codes + tmp = make([]baseOffset, 53) + for i := range tmp[:32] { + tmp[i] = baseOffset{ + // The transformation adds the 3 length. + baseLine: uint32(i) + 3, + addBits: 0, + } + } + fillBase(tmp[32:], 35, 1, 1, 1, 1, 2, 2, 3, 3, 4, 4, 5, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16) + symbolTableX[tableMatchLengths] = tmp + + // Offset codes + tmp = make([]baseOffset, maxOffsetBits+1) + tmp[1] = baseOffset{ + baseLine: 1, + addBits: 1, + } + fillBase(tmp[2:], 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30) + symbolTableX[tableOffsets] = tmp + + // Fill predefined tables and transform them. + // https://github.com/facebook/zstd/blob/dev/doc/zstd_compression_format.md#default-distributions + for i := range fsePredef[:] { + f := &fsePredef[i] + switch tableIndex(i) { + case tableLiteralLengths: + // https://github.com/facebook/zstd/blob/ededcfca57366461021c922720878c81a5854a0a/lib/decompress/zstd_decompress_block.c#L243 + f.actualTableLog = 6 + copy(f.norm[:], []int16{4, 3, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 2, 1, 1, 1, + 2, 2, 2, 2, 2, 2, 2, 2, 2, 3, 2, 1, 1, 1, 1, 1, + -1, -1, -1, -1}) + f.symbolLen = 36 + case tableOffsets: + // https://github.com/facebook/zstd/blob/ededcfca57366461021c922720878c81a5854a0a/lib/decompress/zstd_decompress_block.c#L281 + f.actualTableLog = 5 + copy(f.norm[:], []int16{ + 1, 1, 1, 1, 1, 1, 2, 2, 2, 1, 1, 1, 1, 1, 1, 1, + 1, 1, 1, 1, 1, 1, 1, 1, -1, -1, -1, -1, -1}) + f.symbolLen = 29 + case tableMatchLengths: + //https://github.com/facebook/zstd/blob/ededcfca57366461021c922720878c81a5854a0a/lib/decompress/zstd_decompress_block.c#L304 + f.actualTableLog = 6 + copy(f.norm[:], []int16{ + 1, 4, 3, 2, 2, 2, 2, 2, 2, 1, 1, 1, 1, 1, 1, 1, + 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, + 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, 1, -1, -1, + -1, -1, -1, -1, -1}) + f.symbolLen = 53 + } + if err := f.buildDtable(); err != nil { + panic(fmt.Errorf("building table %v: %v", tableIndex(i), err)) + } + if err := f.transform(symbolTableX[i]); err != nil { + panic(fmt.Errorf("building table %v: %v", tableIndex(i), err)) + } + f.preDefined = true + + // Create encoder as well + enc := &fsePredefEnc[i] + copy(enc.norm[:], f.norm[:]) + enc.symbolLen = f.symbolLen + enc.actualTableLog = f.actualTableLog + if err := enc.buildCTable(); err != nil { + panic(fmt.Errorf("building encoding table %v: %v", tableIndex(i), err)) + } + enc.setBits(bitTables[i]) + enc.preDefined = true + } + }) +} diff --git a/vendor/github.com/klauspost/compress/zstd/hash.go b/vendor/github.com/klauspost/compress/zstd/hash.go new file mode 100644 index 000000000..5d73c21eb --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/hash.go @@ -0,0 +1,35 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +const ( + prime3bytes = 506832829 + prime4bytes = 2654435761 + prime5bytes = 889523592379 + prime6bytes = 227718039650203 + prime7bytes = 58295818150454627 + prime8bytes = 0xcf1bbcdcb7a56463 +) + +// hashLen returns a hash of the lowest mls bytes of with length output bits. +// mls must be >=3 and <=8. Any other value will return hash for 4 bytes. +// length should always be < 32. +// Preferably length and mls should be a constant for inlining. +func hashLen(u uint64, length, mls uint8) uint32 { + switch mls { + case 3: + return (uint32(u<<8) * prime3bytes) >> (32 - length) + case 5: + return uint32(((u << (64 - 40)) * prime5bytes) >> (64 - length)) + case 6: + return uint32(((u << (64 - 48)) * prime6bytes) >> (64 - length)) + case 7: + return uint32(((u << (64 - 56)) * prime7bytes) >> (64 - length)) + case 8: + return uint32((u * prime8bytes) >> (64 - length)) + default: + return (uint32(u) * prime4bytes) >> (32 - length) + } +} diff --git a/vendor/github.com/klauspost/compress/zstd/history.go b/vendor/github.com/klauspost/compress/zstd/history.go new file mode 100644 index 000000000..09164856d --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/history.go @@ -0,0 +1,116 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "github.com/klauspost/compress/huff0" +) + +// history contains the information transferred between blocks. +type history struct { + // Literal decompression + huffTree *huff0.Scratch + + // Sequence decompression + decoders sequenceDecs + recentOffsets [3]int + + // History buffer... + b []byte + + // ignoreBuffer is meant to ignore a number of bytes + // when checking for matches in history + ignoreBuffer int + + windowSize int + allocFrameBuffer int // needed? + error bool + dict *dict +} + +// reset will reset the history to initial state of a frame. +// The history must already have been initialized to the desired size. +func (h *history) reset() { + h.b = h.b[:0] + h.ignoreBuffer = 0 + h.error = false + h.recentOffsets = [3]int{1, 4, 8} + h.decoders.freeDecoders() + h.decoders = sequenceDecs{br: h.decoders.br} + h.freeHuffDecoder() + h.huffTree = nil + h.dict = nil + //printf("history created: %+v (l: %d, c: %d)", *h, len(h.b), cap(h.b)) +} + +func (h *history) freeHuffDecoder() { + if h.huffTree != nil { + if h.dict == nil || h.dict.litEnc != h.huffTree { + huffDecoderPool.Put(h.huffTree) + h.huffTree = nil + } + } +} + +func (h *history) setDict(dict *dict) { + if dict == nil { + return + } + h.dict = dict + h.decoders.litLengths = dict.llDec + h.decoders.offsets = dict.ofDec + h.decoders.matchLengths = dict.mlDec + h.decoders.dict = dict.content + h.recentOffsets = dict.offsets + h.huffTree = dict.litEnc +} + +// append bytes to history. +// This function will make sure there is space for it, +// if the buffer has been allocated with enough extra space. +func (h *history) append(b []byte) { + if len(b) >= h.windowSize { + // Discard all history by simply overwriting + h.b = h.b[:h.windowSize] + copy(h.b, b[len(b)-h.windowSize:]) + return + } + + // If there is space, append it. + if len(b) < cap(h.b)-len(h.b) { + h.b = append(h.b, b...) + return + } + + // Move data down so we only have window size left. + // We know we have less than window size in b at this point. + discard := len(b) + len(h.b) - h.windowSize + copy(h.b, h.b[discard:]) + h.b = h.b[:h.windowSize] + copy(h.b[h.windowSize-len(b):], b) +} + +// ensureBlock will ensure there is space for at least one block... +func (h *history) ensureBlock() { + if cap(h.b) < h.allocFrameBuffer { + h.b = make([]byte, 0, h.allocFrameBuffer) + return + } + + avail := cap(h.b) - len(h.b) + if avail >= h.windowSize || avail > maxCompressedBlockSize { + return + } + // Move data down so we only have window size left. + // We know we have less than window size in b at this point. + discard := len(h.b) - h.windowSize + copy(h.b, h.b[discard:]) + h.b = h.b[:h.windowSize] +} + +// append bytes to history without ever discarding anything. +func (h *history) appendKeep(b []byte) { + h.b = append(h.b, b...) +} diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/LICENSE.txt b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/LICENSE.txt new file mode 100644 index 000000000..24b53065f --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/LICENSE.txt @@ -0,0 +1,22 @@ +Copyright (c) 2016 Caleb Spare + +MIT License + +Permission is hereby granted, free of charge, to any person obtaining +a copy of this software and associated documentation files (the +"Software"), to deal in the Software without restriction, including +without limitation the rights to use, copy, modify, merge, publish, +distribute, sublicense, and/or sell copies of the Software, and to +permit persons to whom the Software is furnished to do so, subject to +the following conditions: + +The above copyright notice and this permission notice shall be +included in all copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, +EXPRESS OR IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF +MERCHANTABILITY, FITNESS FOR A PARTICULAR PURPOSE AND +NONINFRINGEMENT. IN NO EVENT SHALL THE AUTHORS OR COPYRIGHT HOLDERS BE +LIABLE FOR ANY CLAIM, DAMAGES OR OTHER LIABILITY, WHETHER IN AN ACTION +OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, OUT OF OR IN CONNECTION +WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE SOFTWARE. diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/README.md b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/README.md new file mode 100644 index 000000000..777290d44 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/README.md @@ -0,0 +1,71 @@ +# xxhash + +VENDORED: Go to [github.com/cespare/xxhash](https://github.com/cespare/xxhash) for original package. + +xxhash is a Go implementation of the 64-bit [xxHash] algorithm, XXH64. This is a +high-quality hashing algorithm that is much faster than anything in the Go +standard library. + +This package provides a straightforward API: + +``` +func Sum64(b []byte) uint64 +func Sum64String(s string) uint64 +type Digest struct{ ... } + func New() *Digest +``` + +The `Digest` type implements hash.Hash64. Its key methods are: + +``` +func (*Digest) Write([]byte) (int, error) +func (*Digest) WriteString(string) (int, error) +func (*Digest) Sum64() uint64 +``` + +The package is written with optimized pure Go and also contains even faster +assembly implementations for amd64 and arm64. If desired, the `purego` build tag +opts into using the Go code even on those architectures. + +[xxHash]: http://cyan4973.github.io/xxHash/ + +## Compatibility + +This package is in a module and the latest code is in version 2 of the module. +You need a version of Go with at least "minimal module compatibility" to use +github.com/cespare/xxhash/v2: + +* 1.9.7+ for Go 1.9 +* 1.10.3+ for Go 1.10 +* Go 1.11 or later + +I recommend using the latest release of Go. + +## Benchmarks + +Here are some quick benchmarks comparing the pure-Go and assembly +implementations of Sum64. + +| input size | purego | asm | +| ---------- | --------- | --------- | +| 4 B | 1.3 GB/s | 1.2 GB/s | +| 16 B | 2.9 GB/s | 3.5 GB/s | +| 100 B | 6.9 GB/s | 8.1 GB/s | +| 4 KB | 11.7 GB/s | 16.7 GB/s | +| 10 MB | 12.0 GB/s | 17.3 GB/s | + +These numbers were generated on Ubuntu 20.04 with an Intel Xeon Platinum 8252C +CPU using the following commands under Go 1.19.2: + +``` +benchstat <(go test -tags purego -benchtime 500ms -count 15 -bench 'Sum64$') +benchstat <(go test -benchtime 500ms -count 15 -bench 'Sum64$') +``` + +## Projects using this package + +- [InfluxDB](https://github.com/influxdata/influxdb) +- [Prometheus](https://github.com/prometheus/prometheus) +- [VictoriaMetrics](https://github.com/VictoriaMetrics/VictoriaMetrics) +- [FreeCache](https://github.com/coocood/freecache) +- [FastCache](https://github.com/VictoriaMetrics/fastcache) diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash.go b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash.go new file mode 100644 index 000000000..fc40c8200 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash.go @@ -0,0 +1,230 @@ +// Package xxhash implements the 64-bit variant of xxHash (XXH64) as described +// at http://cyan4973.github.io/xxHash/. +// THIS IS VENDORED: Go to github.com/cespare/xxhash for original package. + +package xxhash + +import ( + "encoding/binary" + "errors" + "math/bits" +) + +const ( + prime1 uint64 = 11400714785074694791 + prime2 uint64 = 14029467366897019727 + prime3 uint64 = 1609587929392839161 + prime4 uint64 = 9650029242287828579 + prime5 uint64 = 2870177450012600261 +) + +// Store the primes in an array as well. +// +// The consts are used when possible in Go code to avoid MOVs but we need a +// contiguous array of the assembly code. +var primes = [...]uint64{prime1, prime2, prime3, prime4, prime5} + +// Digest implements hash.Hash64. +type Digest struct { + v1 uint64 + v2 uint64 + v3 uint64 + v4 uint64 + total uint64 + mem [32]byte + n int // how much of mem is used +} + +// New creates a new Digest that computes the 64-bit xxHash algorithm. +func New() *Digest { + var d Digest + d.Reset() + return &d +} + +// Reset clears the Digest's state so that it can be reused. +func (d *Digest) Reset() { + d.v1 = primes[0] + prime2 + d.v2 = prime2 + d.v3 = 0 + d.v4 = -primes[0] + d.total = 0 + d.n = 0 +} + +// Size always returns 8 bytes. +func (d *Digest) Size() int { return 8 } + +// BlockSize always returns 32 bytes. +func (d *Digest) BlockSize() int { return 32 } + +// Write adds more data to d. It always returns len(b), nil. +func (d *Digest) Write(b []byte) (n int, err error) { + n = len(b) + d.total += uint64(n) + + memleft := d.mem[d.n&(len(d.mem)-1):] + + if d.n+n < 32 { + // This new data doesn't even fill the current block. + copy(memleft, b) + d.n += n + return + } + + if d.n > 0 { + // Finish off the partial block. + c := copy(memleft, b) + d.v1 = round(d.v1, u64(d.mem[0:8])) + d.v2 = round(d.v2, u64(d.mem[8:16])) + d.v3 = round(d.v3, u64(d.mem[16:24])) + d.v4 = round(d.v4, u64(d.mem[24:32])) + b = b[c:] + d.n = 0 + } + + if len(b) >= 32 { + // One or more full blocks left. + nw := writeBlocks(d, b) + b = b[nw:] + } + + // Store any remaining partial block. + copy(d.mem[:], b) + d.n = len(b) + + return +} + +// Sum appends the current hash to b and returns the resulting slice. +func (d *Digest) Sum(b []byte) []byte { + s := d.Sum64() + return append( + b, + byte(s>>56), + byte(s>>48), + byte(s>>40), + byte(s>>32), + byte(s>>24), + byte(s>>16), + byte(s>>8), + byte(s), + ) +} + +// Sum64 returns the current hash. +func (d *Digest) Sum64() uint64 { + var h uint64 + + if d.total >= 32 { + v1, v2, v3, v4 := d.v1, d.v2, d.v3, d.v4 + h = rol1(v1) + rol7(v2) + rol12(v3) + rol18(v4) + h = mergeRound(h, v1) + h = mergeRound(h, v2) + h = mergeRound(h, v3) + h = mergeRound(h, v4) + } else { + h = d.v3 + prime5 + } + + h += d.total + + b := d.mem[:d.n&(len(d.mem)-1)] + for ; len(b) >= 8; b = b[8:] { + k1 := round(0, u64(b[:8])) + h ^= k1 + h = rol27(h)*prime1 + prime4 + } + if len(b) >= 4 { + h ^= uint64(u32(b[:4])) * prime1 + h = rol23(h)*prime2 + prime3 + b = b[4:] + } + for ; len(b) > 0; b = b[1:] { + h ^= uint64(b[0]) * prime5 + h = rol11(h) * prime1 + } + + h ^= h >> 33 + h *= prime2 + h ^= h >> 29 + h *= prime3 + h ^= h >> 32 + + return h +} + +const ( + magic = "xxh\x06" + marshaledSize = len(magic) + 8*5 + 32 +) + +// MarshalBinary implements the encoding.BinaryMarshaler interface. +func (d *Digest) MarshalBinary() ([]byte, error) { + b := make([]byte, 0, marshaledSize) + b = append(b, magic...) + b = appendUint64(b, d.v1) + b = appendUint64(b, d.v2) + b = appendUint64(b, d.v3) + b = appendUint64(b, d.v4) + b = appendUint64(b, d.total) + b = append(b, d.mem[:d.n]...) + b = b[:len(b)+len(d.mem)-d.n] + return b, nil +} + +// UnmarshalBinary implements the encoding.BinaryUnmarshaler interface. +func (d *Digest) UnmarshalBinary(b []byte) error { + if len(b) < len(magic) || string(b[:len(magic)]) != magic { + return errors.New("xxhash: invalid hash state identifier") + } + if len(b) != marshaledSize { + return errors.New("xxhash: invalid hash state size") + } + b = b[len(magic):] + b, d.v1 = consumeUint64(b) + b, d.v2 = consumeUint64(b) + b, d.v3 = consumeUint64(b) + b, d.v4 = consumeUint64(b) + b, d.total = consumeUint64(b) + copy(d.mem[:], b) + d.n = int(d.total % uint64(len(d.mem))) + return nil +} + +func appendUint64(b []byte, x uint64) []byte { + var a [8]byte + binary.LittleEndian.PutUint64(a[:], x) + return append(b, a[:]...) +} + +func consumeUint64(b []byte) ([]byte, uint64) { + x := u64(b) + return b[8:], x +} + +func u64(b []byte) uint64 { return binary.LittleEndian.Uint64(b) } +func u32(b []byte) uint32 { return binary.LittleEndian.Uint32(b) } + +func round(acc, input uint64) uint64 { + acc += input * prime2 + acc = rol31(acc) + acc *= prime1 + return acc +} + +func mergeRound(acc, val uint64) uint64 { + val = round(0, val) + acc ^= val + acc = acc*prime1 + prime4 + return acc +} + +func rol1(x uint64) uint64 { return bits.RotateLeft64(x, 1) } +func rol7(x uint64) uint64 { return bits.RotateLeft64(x, 7) } +func rol11(x uint64) uint64 { return bits.RotateLeft64(x, 11) } +func rol12(x uint64) uint64 { return bits.RotateLeft64(x, 12) } +func rol18(x uint64) uint64 { return bits.RotateLeft64(x, 18) } +func rol23(x uint64) uint64 { return bits.RotateLeft64(x, 23) } +func rol27(x uint64) uint64 { return bits.RotateLeft64(x, 27) } +func rol31(x uint64) uint64 { return bits.RotateLeft64(x, 31) } diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.s b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.s new file mode 100644 index 000000000..ddb63aa91 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_amd64.s @@ -0,0 +1,210 @@ +//go:build !appengine && gc && !purego && !noasm +// +build !appengine +// +build gc +// +build !purego +// +build !noasm + +#include "textflag.h" + +// Registers: +#define h AX +#define d AX +#define p SI // pointer to advance through b +#define n DX +#define end BX // loop end +#define v1 R8 +#define v2 R9 +#define v3 R10 +#define v4 R11 +#define x R12 +#define prime1 R13 +#define prime2 R14 +#define prime4 DI + +#define round(acc, x) \ + IMULQ prime2, x \ + ADDQ x, acc \ + ROLQ $31, acc \ + IMULQ prime1, acc + +// round0 performs the operation x = round(0, x). +#define round0(x) \ + IMULQ prime2, x \ + ROLQ $31, x \ + IMULQ prime1, x + +// mergeRound applies a merge round on the two registers acc and x. +// It assumes that prime1, prime2, and prime4 have been loaded. +#define mergeRound(acc, x) \ + round0(x) \ + XORQ x, acc \ + IMULQ prime1, acc \ + ADDQ prime4, acc + +// blockLoop processes as many 32-byte blocks as possible, +// updating v1, v2, v3, and v4. It assumes that there is at least one block +// to process. +#define blockLoop() \ +loop: \ + MOVQ +0(p), x \ + round(v1, x) \ + MOVQ +8(p), x \ + round(v2, x) \ + MOVQ +16(p), x \ + round(v3, x) \ + MOVQ +24(p), x \ + round(v4, x) \ + ADDQ $32, p \ + CMPQ p, end \ + JLE loop + +// func Sum64(b []byte) uint64 +TEXT ·Sum64(SB), NOSPLIT|NOFRAME, $0-32 + // Load fixed primes. + MOVQ ·primes+0(SB), prime1 + MOVQ ·primes+8(SB), prime2 + MOVQ ·primes+24(SB), prime4 + + // Load slice. + MOVQ b_base+0(FP), p + MOVQ b_len+8(FP), n + LEAQ (p)(n*1), end + + // The first loop limit will be len(b)-32. + SUBQ $32, end + + // Check whether we have at least one block. + CMPQ n, $32 + JLT noBlocks + + // Set up initial state (v1, v2, v3, v4). + MOVQ prime1, v1 + ADDQ prime2, v1 + MOVQ prime2, v2 + XORQ v3, v3 + XORQ v4, v4 + SUBQ prime1, v4 + + blockLoop() + + MOVQ v1, h + ROLQ $1, h + MOVQ v2, x + ROLQ $7, x + ADDQ x, h + MOVQ v3, x + ROLQ $12, x + ADDQ x, h + MOVQ v4, x + ROLQ $18, x + ADDQ x, h + + mergeRound(h, v1) + mergeRound(h, v2) + mergeRound(h, v3) + mergeRound(h, v4) + + JMP afterBlocks + +noBlocks: + MOVQ ·primes+32(SB), h + +afterBlocks: + ADDQ n, h + + ADDQ $24, end + CMPQ p, end + JG try4 + +loop8: + MOVQ (p), x + ADDQ $8, p + round0(x) + XORQ x, h + ROLQ $27, h + IMULQ prime1, h + ADDQ prime4, h + + CMPQ p, end + JLE loop8 + +try4: + ADDQ $4, end + CMPQ p, end + JG try1 + + MOVL (p), x + ADDQ $4, p + IMULQ prime1, x + XORQ x, h + + ROLQ $23, h + IMULQ prime2, h + ADDQ ·primes+16(SB), h + +try1: + ADDQ $4, end + CMPQ p, end + JGE finalize + +loop1: + MOVBQZX (p), x + ADDQ $1, p + IMULQ ·primes+32(SB), x + XORQ x, h + ROLQ $11, h + IMULQ prime1, h + + CMPQ p, end + JL loop1 + +finalize: + MOVQ h, x + SHRQ $33, x + XORQ x, h + IMULQ prime2, h + MOVQ h, x + SHRQ $29, x + XORQ x, h + IMULQ ·primes+16(SB), h + MOVQ h, x + SHRQ $32, x + XORQ x, h + + MOVQ h, ret+24(FP) + RET + +// func writeBlocks(d *Digest, b []byte) int +TEXT ·writeBlocks(SB), NOSPLIT|NOFRAME, $0-40 + // Load fixed primes needed for round. + MOVQ ·primes+0(SB), prime1 + MOVQ ·primes+8(SB), prime2 + + // Load slice. + MOVQ b_base+8(FP), p + MOVQ b_len+16(FP), n + LEAQ (p)(n*1), end + SUBQ $32, end + + // Load vN from d. + MOVQ s+0(FP), d + MOVQ 0(d), v1 + MOVQ 8(d), v2 + MOVQ 16(d), v3 + MOVQ 24(d), v4 + + // We don't need to check the loop condition here; this function is + // always called with at least one block of data to process. + blockLoop() + + // Copy vN back to d. + MOVQ v1, 0(d) + MOVQ v2, 8(d) + MOVQ v3, 16(d) + MOVQ v4, 24(d) + + // The number of bytes written is p minus the old base pointer. + SUBQ b_base+8(FP), p + MOVQ p, ret+32(FP) + + RET diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_arm64.s b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_arm64.s new file mode 100644 index 000000000..17901e080 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_arm64.s @@ -0,0 +1,184 @@ +//go:build !appengine && gc && !purego && !noasm +// +build !appengine +// +build gc +// +build !purego +// +build !noasm + +#include "textflag.h" + +// Registers: +#define digest R1 +#define h R2 // return value +#define p R3 // input pointer +#define n R4 // input length +#define nblocks R5 // n / 32 +#define prime1 R7 +#define prime2 R8 +#define prime3 R9 +#define prime4 R10 +#define prime5 R11 +#define v1 R12 +#define v2 R13 +#define v3 R14 +#define v4 R15 +#define x1 R20 +#define x2 R21 +#define x3 R22 +#define x4 R23 + +#define round(acc, x) \ + MADD prime2, acc, x, acc \ + ROR $64-31, acc \ + MUL prime1, acc + +// round0 performs the operation x = round(0, x). +#define round0(x) \ + MUL prime2, x \ + ROR $64-31, x \ + MUL prime1, x + +#define mergeRound(acc, x) \ + round0(x) \ + EOR x, acc \ + MADD acc, prime4, prime1, acc + +// blockLoop processes as many 32-byte blocks as possible, +// updating v1, v2, v3, and v4. It assumes that n >= 32. +#define blockLoop() \ + LSR $5, n, nblocks \ + PCALIGN $16 \ + loop: \ + LDP.P 16(p), (x1, x2) \ + LDP.P 16(p), (x3, x4) \ + round(v1, x1) \ + round(v2, x2) \ + round(v3, x3) \ + round(v4, x4) \ + SUB $1, nblocks \ + CBNZ nblocks, loop + +// func Sum64(b []byte) uint64 +TEXT ·Sum64(SB), NOSPLIT|NOFRAME, $0-32 + LDP b_base+0(FP), (p, n) + + LDP ·primes+0(SB), (prime1, prime2) + LDP ·primes+16(SB), (prime3, prime4) + MOVD ·primes+32(SB), prime5 + + CMP $32, n + CSEL LT, prime5, ZR, h // if n < 32 { h = prime5 } else { h = 0 } + BLT afterLoop + + ADD prime1, prime2, v1 + MOVD prime2, v2 + MOVD $0, v3 + NEG prime1, v4 + + blockLoop() + + ROR $64-1, v1, x1 + ROR $64-7, v2, x2 + ADD x1, x2 + ROR $64-12, v3, x3 + ROR $64-18, v4, x4 + ADD x3, x4 + ADD x2, x4, h + + mergeRound(h, v1) + mergeRound(h, v2) + mergeRound(h, v3) + mergeRound(h, v4) + +afterLoop: + ADD n, h + + TBZ $4, n, try8 + LDP.P 16(p), (x1, x2) + + round0(x1) + + // NOTE: here and below, sequencing the EOR after the ROR (using a + // rotated register) is worth a small but measurable speedup for small + // inputs. + ROR $64-27, h + EOR x1 @> 64-27, h, h + MADD h, prime4, prime1, h + + round0(x2) + ROR $64-27, h + EOR x2 @> 64-27, h, h + MADD h, prime4, prime1, h + +try8: + TBZ $3, n, try4 + MOVD.P 8(p), x1 + + round0(x1) + ROR $64-27, h + EOR x1 @> 64-27, h, h + MADD h, prime4, prime1, h + +try4: + TBZ $2, n, try2 + MOVWU.P 4(p), x2 + + MUL prime1, x2 + ROR $64-23, h + EOR x2 @> 64-23, h, h + MADD h, prime3, prime2, h + +try2: + TBZ $1, n, try1 + MOVHU.P 2(p), x3 + AND $255, x3, x1 + LSR $8, x3, x2 + + MUL prime5, x1 + ROR $64-11, h + EOR x1 @> 64-11, h, h + MUL prime1, h + + MUL prime5, x2 + ROR $64-11, h + EOR x2 @> 64-11, h, h + MUL prime1, h + +try1: + TBZ $0, n, finalize + MOVBU (p), x4 + + MUL prime5, x4 + ROR $64-11, h + EOR x4 @> 64-11, h, h + MUL prime1, h + +finalize: + EOR h >> 33, h + MUL prime2, h + EOR h >> 29, h + MUL prime3, h + EOR h >> 32, h + + MOVD h, ret+24(FP) + RET + +// func writeBlocks(d *Digest, b []byte) int +TEXT ·writeBlocks(SB), NOSPLIT|NOFRAME, $0-40 + LDP ·primes+0(SB), (prime1, prime2) + + // Load state. Assume v[1-4] are stored contiguously. + MOVD d+0(FP), digest + LDP 0(digest), (v1, v2) + LDP 16(digest), (v3, v4) + + LDP b_base+8(FP), (p, n) + + blockLoop() + + // Store updated state. + STP (v1, v2), 0(digest) + STP (v3, v4), 16(digest) + + BIC $31, n + MOVD n, ret+32(FP) + RET diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_asm.go b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_asm.go new file mode 100644 index 000000000..d4221edf4 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_asm.go @@ -0,0 +1,16 @@ +//go:build (amd64 || arm64) && !appengine && gc && !purego && !noasm +// +build amd64 arm64 +// +build !appengine +// +build gc +// +build !purego +// +build !noasm + +package xxhash + +// Sum64 computes the 64-bit xxHash digest of b. +// +//go:noescape +func Sum64(b []byte) uint64 + +//go:noescape +func writeBlocks(s *Digest, b []byte) int diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_other.go b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_other.go new file mode 100644 index 000000000..0be16cefc --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_other.go @@ -0,0 +1,76 @@ +//go:build (!amd64 && !arm64) || appengine || !gc || purego || noasm +// +build !amd64,!arm64 appengine !gc purego noasm + +package xxhash + +// Sum64 computes the 64-bit xxHash digest of b. +func Sum64(b []byte) uint64 { + // A simpler version would be + // d := New() + // d.Write(b) + // return d.Sum64() + // but this is faster, particularly for small inputs. + + n := len(b) + var h uint64 + + if n >= 32 { + v1 := primes[0] + prime2 + v2 := prime2 + v3 := uint64(0) + v4 := -primes[0] + for len(b) >= 32 { + v1 = round(v1, u64(b[0:8:len(b)])) + v2 = round(v2, u64(b[8:16:len(b)])) + v3 = round(v3, u64(b[16:24:len(b)])) + v4 = round(v4, u64(b[24:32:len(b)])) + b = b[32:len(b):len(b)] + } + h = rol1(v1) + rol7(v2) + rol12(v3) + rol18(v4) + h = mergeRound(h, v1) + h = mergeRound(h, v2) + h = mergeRound(h, v3) + h = mergeRound(h, v4) + } else { + h = prime5 + } + + h += uint64(n) + + for ; len(b) >= 8; b = b[8:] { + k1 := round(0, u64(b[:8])) + h ^= k1 + h = rol27(h)*prime1 + prime4 + } + if len(b) >= 4 { + h ^= uint64(u32(b[:4])) * prime1 + h = rol23(h)*prime2 + prime3 + b = b[4:] + } + for ; len(b) > 0; b = b[1:] { + h ^= uint64(b[0]) * prime5 + h = rol11(h) * prime1 + } + + h ^= h >> 33 + h *= prime2 + h ^= h >> 29 + h *= prime3 + h ^= h >> 32 + + return h +} + +func writeBlocks(d *Digest, b []byte) int { + v1, v2, v3, v4 := d.v1, d.v2, d.v3, d.v4 + n := len(b) + for len(b) >= 32 { + v1 = round(v1, u64(b[0:8:len(b)])) + v2 = round(v2, u64(b[8:16:len(b)])) + v3 = round(v3, u64(b[16:24:len(b)])) + v4 = round(v4, u64(b[24:32:len(b)])) + b = b[32:len(b):len(b)] + } + d.v1, d.v2, d.v3, d.v4 = v1, v2, v3, v4 + return n - len(b) +} diff --git a/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_safe.go b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_safe.go new file mode 100644 index 000000000..6f3b0cb10 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/internal/xxhash/xxhash_safe.go @@ -0,0 +1,11 @@ +package xxhash + +// Sum64String computes the 64-bit xxHash digest of s. +func Sum64String(s string) uint64 { + return Sum64([]byte(s)) +} + +// WriteString adds more data to d. It always returns len(s), nil. +func (d *Digest) WriteString(s string) (n int, err error) { + return d.Write([]byte(s)) +} diff --git a/vendor/github.com/klauspost/compress/zstd/matchlen_amd64.go b/vendor/github.com/klauspost/compress/zstd/matchlen_amd64.go new file mode 100644 index 000000000..f41932b7a --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/matchlen_amd64.go @@ -0,0 +1,16 @@ +//go:build amd64 && !appengine && !noasm && gc +// +build amd64,!appengine,!noasm,gc + +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. + +package zstd + +// matchLen returns how many bytes match in a and b +// +// It assumes that: +// +// len(a) <= len(b) and len(a) > 0 +// +//go:noescape +func matchLen(a []byte, b []byte) int diff --git a/vendor/github.com/klauspost/compress/zstd/matchlen_amd64.s b/vendor/github.com/klauspost/compress/zstd/matchlen_amd64.s new file mode 100644 index 000000000..9a7655c0f --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/matchlen_amd64.s @@ -0,0 +1,68 @@ +// Copied from S2 implementation. + +//go:build !appengine && !noasm && gc && !noasm + +#include "textflag.h" + +// func matchLen(a []byte, b []byte) int +// Requires: BMI +TEXT ·matchLen(SB), NOSPLIT, $0-56 + MOVQ a_base+0(FP), AX + MOVQ b_base+24(FP), CX + MOVQ a_len+8(FP), DX + + // matchLen + XORL SI, SI + CMPL DX, $0x08 + JB matchlen_match4_standalone + +matchlen_loopback_standalone: + MOVQ (AX)(SI*1), BX + XORQ (CX)(SI*1), BX + TESTQ BX, BX + JZ matchlen_loop_standalone + +#ifdef GOAMD64_v3 + TZCNTQ BX, BX +#else + BSFQ BX, BX +#endif + SARQ $0x03, BX + LEAL (SI)(BX*1), SI + JMP gen_match_len_end + +matchlen_loop_standalone: + LEAL -8(DX), DX + LEAL 8(SI), SI + CMPL DX, $0x08 + JAE matchlen_loopback_standalone + +matchlen_match4_standalone: + CMPL DX, $0x04 + JB matchlen_match2_standalone + MOVL (AX)(SI*1), BX + CMPL (CX)(SI*1), BX + JNE matchlen_match2_standalone + LEAL -4(DX), DX + LEAL 4(SI), SI + +matchlen_match2_standalone: + CMPL DX, $0x02 + JB matchlen_match1_standalone + MOVW (AX)(SI*1), BX + CMPW (CX)(SI*1), BX + JNE matchlen_match1_standalone + LEAL -2(DX), DX + LEAL 2(SI), SI + +matchlen_match1_standalone: + CMPL DX, $0x01 + JB gen_match_len_end + MOVB (AX)(SI*1), BL + CMPB (CX)(SI*1), BL + JNE gen_match_len_end + INCL SI + +gen_match_len_end: + MOVQ SI, ret+48(FP) + RET diff --git a/vendor/github.com/klauspost/compress/zstd/matchlen_generic.go b/vendor/github.com/klauspost/compress/zstd/matchlen_generic.go new file mode 100644 index 000000000..57b9c31c0 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/matchlen_generic.go @@ -0,0 +1,33 @@ +//go:build !amd64 || appengine || !gc || noasm +// +build !amd64 appengine !gc noasm + +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. + +package zstd + +import ( + "encoding/binary" + "math/bits" +) + +// matchLen returns the maximum common prefix length of a and b. +// a must be the shortest of the two. +func matchLen(a, b []byte) (n int) { + for ; len(a) >= 8 && len(b) >= 8; a, b = a[8:], b[8:] { + diff := binary.LittleEndian.Uint64(a) ^ binary.LittleEndian.Uint64(b) + if diff != 0 { + return n + bits.TrailingZeros64(diff)>>3 + } + n += 8 + } + + for i := range a { + if a[i] != b[i] { + break + } + n++ + } + return n + +} diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec.go b/vendor/github.com/klauspost/compress/zstd/seqdec.go new file mode 100644 index 000000000..9405fcf10 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/seqdec.go @@ -0,0 +1,508 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "errors" + "fmt" + "io" +) + +type seq struct { + litLen uint32 + matchLen uint32 + offset uint32 + + // Codes are stored here for the encoder + // so they only have to be looked up once. + llCode, mlCode, ofCode uint8 +} + +type seqVals struct { + ll, ml, mo int +} + +func (s seq) String() string { + if s.offset <= 3 { + if s.offset == 0 { + return fmt.Sprint("litLen:", s.litLen, ", matchLen:", s.matchLen+zstdMinMatch, ", offset: INVALID (0)") + } + return fmt.Sprint("litLen:", s.litLen, ", matchLen:", s.matchLen+zstdMinMatch, ", offset:", s.offset, " (repeat)") + } + return fmt.Sprint("litLen:", s.litLen, ", matchLen:", s.matchLen+zstdMinMatch, ", offset:", s.offset-3, " (new)") +} + +type seqCompMode uint8 + +const ( + compModePredefined seqCompMode = iota + compModeRLE + compModeFSE + compModeRepeat +) + +type sequenceDec struct { + // decoder keeps track of the current state and updates it from the bitstream. + fse *fseDecoder + state fseState + repeat bool +} + +// init the state of the decoder with input from stream. +func (s *sequenceDec) init(br *bitReader) error { + if s.fse == nil { + return errors.New("sequence decoder not defined") + } + s.state.init(br, s.fse.actualTableLog, s.fse.dt[:1< cap(s.out) { + addBytes := s.seqSize + len(s.out) + s.out = append(s.out, make([]byte, addBytes)...) + s.out = s.out[:len(s.out)-addBytes] + } + + if debugDecoder { + printf("Execute %d seqs with hist %d, dict %d, literals: %d into %d bytes\n", len(seqs), len(hist), len(s.dict), len(s.literals), s.seqSize) + } + + var t = len(s.out) + out := s.out[:t+s.seqSize] + + for _, seq := range seqs { + // Add literals + copy(out[t:], s.literals[:seq.ll]) + t += seq.ll + s.literals = s.literals[seq.ll:] + + // Copy from dictionary... + if seq.mo > t+len(hist) || seq.mo > s.windowSize { + if len(s.dict) == 0 { + return fmt.Errorf("match offset (%d) bigger than current history (%d)", seq.mo, t+len(hist)) + } + + // we may be in dictionary. + dictO := len(s.dict) - (seq.mo - (t + len(hist))) + if dictO < 0 || dictO >= len(s.dict) { + return fmt.Errorf("match offset (%d) bigger than current history+dict (%d)", seq.mo, t+len(hist)+len(s.dict)) + } + end := dictO + seq.ml + if end > len(s.dict) { + n := len(s.dict) - dictO + copy(out[t:], s.dict[dictO:]) + t += n + seq.ml -= n + } else { + copy(out[t:], s.dict[dictO:end]) + t += end - dictO + continue + } + } + + // Copy from history. + if v := seq.mo - t; v > 0 { + // v is the start position in history from end. + start := len(hist) - v + if seq.ml > v { + // Some goes into current block. + // Copy remainder of history + copy(out[t:], hist[start:]) + t += v + seq.ml -= v + } else { + copy(out[t:], hist[start:start+seq.ml]) + t += seq.ml + continue + } + } + // We must be in current buffer now + if seq.ml > 0 { + start := t - seq.mo + if seq.ml <= t-start { + // No overlap + copy(out[t:], out[start:start+seq.ml]) + t += seq.ml + continue + } else { + // Overlapping copy + // Extend destination slice and copy one byte at the time. + src := out[start : start+seq.ml] + dst := out[t:] + dst = dst[:len(src)] + t += len(src) + // Destination is the space we just added. + for i := range src { + dst[i] = src[i] + } + } + } + } + + // Add final literals + copy(out[t:], s.literals) + if debugDecoder { + t += len(s.literals) + if t != len(out) { + panic(fmt.Errorf("length mismatch, want %d, got %d, ss: %d", len(out), t, s.seqSize)) + } + } + s.out = out + + return nil +} + +// decode sequences from the stream with the provided history. +func (s *sequenceDecs) decodeSync(hist []byte) error { + supported, err := s.decodeSyncSimple(hist) + if supported { + return err + } + + br := s.br + seqs := s.nSeqs + startSize := len(s.out) + // Grab full sizes tables, to avoid bounds checks. + llTable, mlTable, ofTable := s.litLengths.fse.dt[:maxTablesize], s.matchLengths.fse.dt[:maxTablesize], s.offsets.fse.dt[:maxTablesize] + llState, mlState, ofState := s.litLengths.state.state, s.matchLengths.state.state, s.offsets.state.state + out := s.out + maxBlockSize := maxCompressedBlockSize + if s.windowSize < maxBlockSize { + maxBlockSize = s.windowSize + } + + if debugDecoder { + println("decodeSync: decoding", seqs, "sequences", br.remain(), "bits remain on stream") + } + for i := seqs - 1; i >= 0; i-- { + if br.overread() { + printf("reading sequence %d, exceeded available data. Overread by %d\n", seqs-i, -br.remain()) + return io.ErrUnexpectedEOF + } + var ll, mo, ml int + if br.off > 4+((maxOffsetBits+16+16)>>3) { + // inlined function: + // ll, mo, ml = s.nextFast(br, llState, mlState, ofState) + + // Final will not read from stream. + var llB, mlB, moB uint8 + ll, llB = llState.final() + ml, mlB = mlState.final() + mo, moB = ofState.final() + + // extra bits are stored in reverse order. + br.fillFast() + mo += br.getBits(moB) + if s.maxBits > 32 { + br.fillFast() + } + ml += br.getBits(mlB) + ll += br.getBits(llB) + + if moB > 1 { + s.prevOffset[2] = s.prevOffset[1] + s.prevOffset[1] = s.prevOffset[0] + s.prevOffset[0] = mo + } else { + // mo = s.adjustOffset(mo, ll, moB) + // Inlined for rather big speedup + if ll == 0 { + // There is an exception though, when current sequence's literals_length = 0. + // In this case, repeated offsets are shifted by one, so an offset_value of 1 means Repeated_Offset2, + // an offset_value of 2 means Repeated_Offset3, and an offset_value of 3 means Repeated_Offset1 - 1_byte. + mo++ + } + + if mo == 0 { + mo = s.prevOffset[0] + } else { + var temp int + if mo == 3 { + temp = s.prevOffset[0] - 1 + } else { + temp = s.prevOffset[mo] + } + + if temp == 0 { + // 0 is not valid; input is corrupted; force offset to 1 + println("WARNING: temp was 0") + temp = 1 + } + + if mo != 1 { + s.prevOffset[2] = s.prevOffset[1] + } + s.prevOffset[1] = s.prevOffset[0] + s.prevOffset[0] = temp + mo = temp + } + } + br.fillFast() + } else { + ll, mo, ml = s.next(br, llState, mlState, ofState) + br.fill() + } + + if debugSequences { + println("Seq", seqs-i-1, "Litlen:", ll, "mo:", mo, "(abs) ml:", ml) + } + + if ll > len(s.literals) { + return fmt.Errorf("unexpected literal count, want %d bytes, but only %d is available", ll, len(s.literals)) + } + size := ll + ml + len(out) + if size-startSize > maxBlockSize { + return fmt.Errorf("output bigger than max block size (%d)", maxBlockSize) + } + if size > cap(out) { + // Not enough size, which can happen under high volume block streaming conditions + // but could be if destination slice is too small for sync operations. + // over-allocating here can create a large amount of GC pressure so we try to keep + // it as contained as possible + used := len(out) - startSize + addBytes := 256 + ll + ml + used>>2 + // Clamp to max block size. + if used+addBytes > maxBlockSize { + addBytes = maxBlockSize - used + } + out = append(out, make([]byte, addBytes)...) + out = out[:len(out)-addBytes] + } + if ml > maxMatchLen { + return fmt.Errorf("match len (%d) bigger than max allowed length", ml) + } + + // Add literals + out = append(out, s.literals[:ll]...) + s.literals = s.literals[ll:] + + if mo == 0 && ml > 0 { + return fmt.Errorf("zero matchoff and matchlen (%d) > 0", ml) + } + + if mo > len(out)+len(hist) || mo > s.windowSize { + if len(s.dict) == 0 { + return fmt.Errorf("match offset (%d) bigger than current history (%d)", mo, len(out)+len(hist)-startSize) + } + + // we may be in dictionary. + dictO := len(s.dict) - (mo - (len(out) + len(hist))) + if dictO < 0 || dictO >= len(s.dict) { + return fmt.Errorf("match offset (%d) bigger than current history (%d)", mo, len(out)+len(hist)-startSize) + } + end := dictO + ml + if end > len(s.dict) { + out = append(out, s.dict[dictO:]...) + ml -= len(s.dict) - dictO + } else { + out = append(out, s.dict[dictO:end]...) + mo = 0 + ml = 0 + } + } + + // Copy from history. + // TODO: Blocks without history could be made to ignore this completely. + if v := mo - len(out); v > 0 { + // v is the start position in history from end. + start := len(hist) - v + if ml > v { + // Some goes into current block. + // Copy remainder of history + out = append(out, hist[start:]...) + ml -= v + } else { + out = append(out, hist[start:start+ml]...) + ml = 0 + } + } + // We must be in current buffer now + if ml > 0 { + start := len(out) - mo + if ml <= len(out)-start { + // No overlap + out = append(out, out[start:start+ml]...) + } else { + // Overlapping copy + // Extend destination slice and copy one byte at the time. + out = out[:len(out)+ml] + src := out[start : start+ml] + // Destination is the space we just added. + dst := out[len(out)-ml:] + dst = dst[:len(src)] + for i := range src { + dst[i] = src[i] + } + } + } + if i == 0 { + // This is the last sequence, so we shouldn't update state. + break + } + + // Manually inlined, ~ 5-20% faster + // Update all 3 states at once. Approx 20% faster. + nBits := llState.nbBits() + mlState.nbBits() + ofState.nbBits() + if nBits == 0 { + llState = llTable[llState.newState()&maxTableMask] + mlState = mlTable[mlState.newState()&maxTableMask] + ofState = ofTable[ofState.newState()&maxTableMask] + } else { + bits := br.get32BitsFast(nBits) + + lowBits := uint16(bits >> ((ofState.nbBits() + mlState.nbBits()) & 31)) + llState = llTable[(llState.newState()+lowBits)&maxTableMask] + + lowBits = uint16(bits >> (ofState.nbBits() & 31)) + lowBits &= bitMask[mlState.nbBits()&15] + mlState = mlTable[(mlState.newState()+lowBits)&maxTableMask] + + lowBits = uint16(bits) & bitMask[ofState.nbBits()&15] + ofState = ofTable[(ofState.newState()+lowBits)&maxTableMask] + } + } + + if size := len(s.literals) + len(out) - startSize; size > maxBlockSize { + return fmt.Errorf("output bigger than max block size (%d)", maxBlockSize) + } + + // Add final literals + s.out = append(out, s.literals...) + return br.close() +} + +var bitMask [16]uint16 + +func init() { + for i := range bitMask[:] { + bitMask[i] = uint16((1 << uint(i)) - 1) + } +} + +func (s *sequenceDecs) next(br *bitReader, llState, mlState, ofState decSymbol) (ll, mo, ml int) { + // Final will not read from stream. + ll, llB := llState.final() + ml, mlB := mlState.final() + mo, moB := ofState.final() + + // extra bits are stored in reverse order. + br.fill() + if s.maxBits <= 32 { + mo += br.getBits(moB) + ml += br.getBits(mlB) + ll += br.getBits(llB) + } else { + mo += br.getBits(moB) + br.fill() + // matchlength+literal length, max 32 bits + ml += br.getBits(mlB) + ll += br.getBits(llB) + + } + mo = s.adjustOffset(mo, ll, moB) + return +} + +func (s *sequenceDecs) adjustOffset(offset, litLen int, offsetB uint8) int { + if offsetB > 1 { + s.prevOffset[2] = s.prevOffset[1] + s.prevOffset[1] = s.prevOffset[0] + s.prevOffset[0] = offset + return offset + } + + if litLen == 0 { + // There is an exception though, when current sequence's literals_length = 0. + // In this case, repeated offsets are shifted by one, so an offset_value of 1 means Repeated_Offset2, + // an offset_value of 2 means Repeated_Offset3, and an offset_value of 3 means Repeated_Offset1 - 1_byte. + offset++ + } + + if offset == 0 { + return s.prevOffset[0] + } + var temp int + if offset == 3 { + temp = s.prevOffset[0] - 1 + } else { + temp = s.prevOffset[offset] + } + + if temp == 0 { + // 0 is not valid; input is corrupted; force offset to 1 + println("temp was 0") + temp = 1 + } + + if offset != 1 { + s.prevOffset[2] = s.prevOffset[1] + } + s.prevOffset[1] = s.prevOffset[0] + s.prevOffset[0] = temp + return temp +} diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.go b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.go new file mode 100644 index 000000000..8adabd828 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.go @@ -0,0 +1,394 @@ +//go:build amd64 && !appengine && !noasm && gc +// +build amd64,!appengine,!noasm,gc + +package zstd + +import ( + "fmt" + "io" + + "github.com/klauspost/compress/internal/cpuinfo" +) + +type decodeSyncAsmContext struct { + llTable []decSymbol + mlTable []decSymbol + ofTable []decSymbol + llState uint64 + mlState uint64 + ofState uint64 + iteration int + litRemain int + out []byte + outPosition int + literals []byte + litPosition int + history []byte + windowSize int + ll int // set on error (not for all errors, please refer to _generate/gen.go) + ml int // set on error (not for all errors, please refer to _generate/gen.go) + mo int // set on error (not for all errors, please refer to _generate/gen.go) +} + +// sequenceDecs_decodeSync_amd64 implements the main loop of sequenceDecs.decodeSync in x86 asm. +// +// Please refer to seqdec_generic.go for the reference implementation. +// +//go:noescape +func sequenceDecs_decodeSync_amd64(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int + +// sequenceDecs_decodeSync_bmi2 implements the main loop of sequenceDecs.decodeSync in x86 asm with BMI2 extensions. +// +//go:noescape +func sequenceDecs_decodeSync_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int + +// sequenceDecs_decodeSync_safe_amd64 does the same as above, but does not write more than output buffer. +// +//go:noescape +func sequenceDecs_decodeSync_safe_amd64(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int + +// sequenceDecs_decodeSync_safe_bmi2 does the same as above, but does not write more than output buffer. +// +//go:noescape +func sequenceDecs_decodeSync_safe_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int + +// decode sequences from the stream with the provided history but without a dictionary. +func (s *sequenceDecs) decodeSyncSimple(hist []byte) (bool, error) { + if len(s.dict) > 0 { + return false, nil + } + if s.maxSyncLen == 0 && cap(s.out)-len(s.out) < maxCompressedBlockSize { + return false, nil + } + + // FIXME: Using unsafe memory copies leads to rare, random crashes + // with fuzz testing. It is therefore disabled for now. + const useSafe = true + /* + useSafe := false + if s.maxSyncLen == 0 && cap(s.out)-len(s.out) < maxCompressedBlockSizeAlloc { + useSafe = true + } + if s.maxSyncLen > 0 && cap(s.out)-len(s.out)-compressedBlockOverAlloc < int(s.maxSyncLen) { + useSafe = true + } + if cap(s.literals) < len(s.literals)+compressedBlockOverAlloc { + useSafe = true + } + */ + + br := s.br + + maxBlockSize := maxCompressedBlockSize + if s.windowSize < maxBlockSize { + maxBlockSize = s.windowSize + } + + ctx := decodeSyncAsmContext{ + llTable: s.litLengths.fse.dt[:maxTablesize], + mlTable: s.matchLengths.fse.dt[:maxTablesize], + ofTable: s.offsets.fse.dt[:maxTablesize], + llState: uint64(s.litLengths.state.state), + mlState: uint64(s.matchLengths.state.state), + ofState: uint64(s.offsets.state.state), + iteration: s.nSeqs - 1, + litRemain: len(s.literals), + out: s.out, + outPosition: len(s.out), + literals: s.literals, + windowSize: s.windowSize, + history: hist, + } + + s.seqSize = 0 + startSize := len(s.out) + + var errCode int + if cpuinfo.HasBMI2() { + if useSafe { + errCode = sequenceDecs_decodeSync_safe_bmi2(s, br, &ctx) + } else { + errCode = sequenceDecs_decodeSync_bmi2(s, br, &ctx) + } + } else { + if useSafe { + errCode = sequenceDecs_decodeSync_safe_amd64(s, br, &ctx) + } else { + errCode = sequenceDecs_decodeSync_amd64(s, br, &ctx) + } + } + switch errCode { + case noError: + break + + case errorMatchLenOfsMismatch: + return true, fmt.Errorf("zero matchoff and matchlen (%d) > 0", ctx.ml) + + case errorMatchLenTooBig: + return true, fmt.Errorf("match len (%d) bigger than max allowed length", ctx.ml) + + case errorMatchOffTooBig: + return true, fmt.Errorf("match offset (%d) bigger than current history (%d)", + ctx.mo, ctx.outPosition+len(hist)-startSize) + + case errorNotEnoughLiterals: + return true, fmt.Errorf("unexpected literal count, want %d bytes, but only %d is available", + ctx.ll, ctx.litRemain+ctx.ll) + + case errorOverread: + return true, io.ErrUnexpectedEOF + + case errorNotEnoughSpace: + size := ctx.outPosition + ctx.ll + ctx.ml + if debugDecoder { + println("msl:", s.maxSyncLen, "cap", cap(s.out), "bef:", startSize, "sz:", size-startSize, "mbs:", maxBlockSize, "outsz:", cap(s.out)-startSize) + } + return true, fmt.Errorf("output bigger than max block size (%d)", maxBlockSize) + + default: + return true, fmt.Errorf("sequenceDecs_decode returned erronous code %d", errCode) + } + + s.seqSize += ctx.litRemain + if s.seqSize > maxBlockSize { + return true, fmt.Errorf("output bigger than max block size (%d)", maxBlockSize) + } + err := br.close() + if err != nil { + printf("Closing sequences: %v, %+v\n", err, *br) + return true, err + } + + s.literals = s.literals[ctx.litPosition:] + t := ctx.outPosition + s.out = s.out[:t] + + // Add final literals + s.out = append(s.out, s.literals...) + if debugDecoder { + t += len(s.literals) + if t != len(s.out) { + panic(fmt.Errorf("length mismatch, want %d, got %d", len(s.out), t)) + } + } + + return true, nil +} + +// -------------------------------------------------------------------------------- + +type decodeAsmContext struct { + llTable []decSymbol + mlTable []decSymbol + ofTable []decSymbol + llState uint64 + mlState uint64 + ofState uint64 + iteration int + seqs []seqVals + litRemain int +} + +const noError = 0 + +// error reported when mo == 0 && ml > 0 +const errorMatchLenOfsMismatch = 1 + +// error reported when ml > maxMatchLen +const errorMatchLenTooBig = 2 + +// error reported when mo > available history or mo > s.windowSize +const errorMatchOffTooBig = 3 + +// error reported when the sum of literal lengths exeeceds the literal buffer size +const errorNotEnoughLiterals = 4 + +// error reported when capacity of `out` is too small +const errorNotEnoughSpace = 5 + +// error reported when bits are overread. +const errorOverread = 6 + +// sequenceDecs_decode implements the main loop of sequenceDecs in x86 asm. +// +// Please refer to seqdec_generic.go for the reference implementation. +// +//go:noescape +func sequenceDecs_decode_amd64(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int + +// sequenceDecs_decode implements the main loop of sequenceDecs in x86 asm. +// +// Please refer to seqdec_generic.go for the reference implementation. +// +//go:noescape +func sequenceDecs_decode_56_amd64(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int + +// sequenceDecs_decode implements the main loop of sequenceDecs in x86 asm with BMI2 extensions. +// +//go:noescape +func sequenceDecs_decode_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int + +// sequenceDecs_decode implements the main loop of sequenceDecs in x86 asm with BMI2 extensions. +// +//go:noescape +func sequenceDecs_decode_56_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int + +// decode sequences from the stream without the provided history. +func (s *sequenceDecs) decode(seqs []seqVals) error { + br := s.br + + maxBlockSize := maxCompressedBlockSize + if s.windowSize < maxBlockSize { + maxBlockSize = s.windowSize + } + + ctx := decodeAsmContext{ + llTable: s.litLengths.fse.dt[:maxTablesize], + mlTable: s.matchLengths.fse.dt[:maxTablesize], + ofTable: s.offsets.fse.dt[:maxTablesize], + llState: uint64(s.litLengths.state.state), + mlState: uint64(s.matchLengths.state.state), + ofState: uint64(s.offsets.state.state), + seqs: seqs, + iteration: len(seqs) - 1, + litRemain: len(s.literals), + } + + if debugDecoder { + println("decode: decoding", len(seqs), "sequences", br.remain(), "bits remain on stream") + } + + s.seqSize = 0 + lte56bits := s.maxBits+s.offsets.fse.actualTableLog+s.matchLengths.fse.actualTableLog+s.litLengths.fse.actualTableLog <= 56 + var errCode int + if cpuinfo.HasBMI2() { + if lte56bits { + errCode = sequenceDecs_decode_56_bmi2(s, br, &ctx) + } else { + errCode = sequenceDecs_decode_bmi2(s, br, &ctx) + } + } else { + if lte56bits { + errCode = sequenceDecs_decode_56_amd64(s, br, &ctx) + } else { + errCode = sequenceDecs_decode_amd64(s, br, &ctx) + } + } + if errCode != 0 { + i := len(seqs) - ctx.iteration - 1 + switch errCode { + case errorMatchLenOfsMismatch: + ml := ctx.seqs[i].ml + return fmt.Errorf("zero matchoff and matchlen (%d) > 0", ml) + + case errorMatchLenTooBig: + ml := ctx.seqs[i].ml + return fmt.Errorf("match len (%d) bigger than max allowed length", ml) + + case errorNotEnoughLiterals: + ll := ctx.seqs[i].ll + return fmt.Errorf("unexpected literal count, want %d bytes, but only %d is available", ll, ctx.litRemain+ll) + case errorOverread: + return io.ErrUnexpectedEOF + } + + return fmt.Errorf("sequenceDecs_decode_amd64 returned erronous code %d", errCode) + } + + if ctx.litRemain < 0 { + return fmt.Errorf("literal count is too big: total available %d, total requested %d", + len(s.literals), len(s.literals)-ctx.litRemain) + } + + s.seqSize += ctx.litRemain + if s.seqSize > maxBlockSize { + return fmt.Errorf("output bigger than max block size (%d)", maxBlockSize) + } + if debugDecoder { + println("decode: ", br.remain(), "bits remain on stream. code:", errCode) + } + err := br.close() + if err != nil { + printf("Closing sequences: %v, %+v\n", err, *br) + } + return err +} + +// -------------------------------------------------------------------------------- + +type executeAsmContext struct { + seqs []seqVals + seqIndex int + out []byte + history []byte + literals []byte + outPosition int + litPosition int + windowSize int +} + +// sequenceDecs_executeSimple_amd64 implements the main loop of sequenceDecs.executeSimple in x86 asm. +// +// Returns false if a match offset is too big. +// +// Please refer to seqdec_generic.go for the reference implementation. +// +//go:noescape +func sequenceDecs_executeSimple_amd64(ctx *executeAsmContext) bool + +// Same as above, but with safe memcopies +// +//go:noescape +func sequenceDecs_executeSimple_safe_amd64(ctx *executeAsmContext) bool + +// executeSimple handles cases when dictionary is not used. +func (s *sequenceDecs) executeSimple(seqs []seqVals, hist []byte) error { + // Ensure we have enough output size... + if len(s.out)+s.seqSize+compressedBlockOverAlloc > cap(s.out) { + addBytes := s.seqSize + len(s.out) + compressedBlockOverAlloc + s.out = append(s.out, make([]byte, addBytes)...) + s.out = s.out[:len(s.out)-addBytes] + } + + if debugDecoder { + printf("Execute %d seqs with literals: %d into %d bytes\n", len(seqs), len(s.literals), s.seqSize) + } + + var t = len(s.out) + out := s.out[:t+s.seqSize] + + ctx := executeAsmContext{ + seqs: seqs, + seqIndex: 0, + out: out, + history: hist, + outPosition: t, + litPosition: 0, + literals: s.literals, + windowSize: s.windowSize, + } + var ok bool + if cap(s.literals) < len(s.literals)+compressedBlockOverAlloc { + ok = sequenceDecs_executeSimple_safe_amd64(&ctx) + } else { + ok = sequenceDecs_executeSimple_amd64(&ctx) + } + if !ok { + return fmt.Errorf("match offset (%d) bigger than current history (%d)", + seqs[ctx.seqIndex].mo, ctx.outPosition+len(hist)) + } + s.literals = s.literals[ctx.litPosition:] + t = ctx.outPosition + + // Add final literals + copy(out[t:], s.literals) + if debugDecoder { + t += len(s.literals) + if t != len(out) { + panic(fmt.Errorf("length mismatch, want %d, got %d, ss: %d", len(out), t, s.seqSize)) + } + } + s.out = out + + return nil +} diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s new file mode 100644 index 000000000..b6f4ba6fc --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/seqdec_amd64.s @@ -0,0 +1,4175 @@ +// Code generated by command: go run gen.go -out ../seqdec_amd64.s -pkg=zstd. DO NOT EDIT. + +//go:build !appengine && !noasm && gc && !noasm + +// func sequenceDecs_decode_amd64(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int +// Requires: CMOV +TEXT ·sequenceDecs_decode_amd64(SB), $8-32 + MOVQ br+8(FP), AX + MOVQ 32(AX), DX + MOVBQZX 40(AX), BX + MOVQ 24(AX), SI + MOVQ (AX), AX + ADDQ SI, AX + MOVQ AX, (SP) + MOVQ ctx+16(FP), AX + MOVQ 72(AX), DI + MOVQ 80(AX), R8 + MOVQ 88(AX), R9 + MOVQ 104(AX), R10 + MOVQ s+0(FP), AX + MOVQ 144(AX), R11 + MOVQ 152(AX), R12 + MOVQ 160(AX), R13 + +sequenceDecs_decode_amd64_main_loop: + MOVQ (SP), R14 + + // Fill bitreader to have enough for the offset and match length. + CMPQ SI, $0x08 + JL sequenceDecs_decode_amd64_fill_byte_by_byte + MOVQ BX, AX + SHRQ $0x03, AX + SUBQ AX, R14 + MOVQ (R14), DX + SUBQ AX, SI + ANDQ $0x07, BX + JMP sequenceDecs_decode_amd64_fill_end + +sequenceDecs_decode_amd64_fill_byte_by_byte: + CMPQ SI, $0x00 + JLE sequenceDecs_decode_amd64_fill_check_overread + CMPQ BX, $0x07 + JLE sequenceDecs_decode_amd64_fill_end + SHLQ $0x08, DX + SUBQ $0x01, R14 + SUBQ $0x01, SI + SUBQ $0x08, BX + MOVBQZX (R14), AX + ORQ AX, DX + JMP sequenceDecs_decode_amd64_fill_byte_by_byte + +sequenceDecs_decode_amd64_fill_check_overread: + CMPQ BX, $0x40 + JA error_overread + +sequenceDecs_decode_amd64_fill_end: + // Update offset + MOVQ R9, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_amd64_of_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_amd64_of_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_amd64_of_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_amd64_of_update_zero: + MOVQ AX, 16(R10) + + // Update match length + MOVQ R8, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_amd64_ml_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_amd64_ml_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_amd64_ml_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_amd64_ml_update_zero: + MOVQ AX, 8(R10) + + // Fill bitreader to have enough for the remaining + CMPQ SI, $0x08 + JL sequenceDecs_decode_amd64_fill_2_byte_by_byte + MOVQ BX, AX + SHRQ $0x03, AX + SUBQ AX, R14 + MOVQ (R14), DX + SUBQ AX, SI + ANDQ $0x07, BX + JMP sequenceDecs_decode_amd64_fill_2_end + +sequenceDecs_decode_amd64_fill_2_byte_by_byte: + CMPQ SI, $0x00 + JLE sequenceDecs_decode_amd64_fill_2_check_overread + CMPQ BX, $0x07 + JLE sequenceDecs_decode_amd64_fill_2_end + SHLQ $0x08, DX + SUBQ $0x01, R14 + SUBQ $0x01, SI + SUBQ $0x08, BX + MOVBQZX (R14), AX + ORQ AX, DX + JMP sequenceDecs_decode_amd64_fill_2_byte_by_byte + +sequenceDecs_decode_amd64_fill_2_check_overread: + CMPQ BX, $0x40 + JA error_overread + +sequenceDecs_decode_amd64_fill_2_end: + // Update literal length + MOVQ DI, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_amd64_ll_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_amd64_ll_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_amd64_ll_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_amd64_ll_update_zero: + MOVQ AX, (R10) + + // Fill bitreader for state updates + MOVQ R14, (SP) + MOVQ R9, AX + SHRQ $0x08, AX + MOVBQZX AL, AX + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decode_amd64_skip_update + + // Update Literal Length State + MOVBQZX DI, R14 + SHRQ $0x10, DI + MOVWQZX DI, DI + LEAQ (BX)(R14*1), CX + MOVQ DX, R15 + MOVQ CX, BX + ROLQ CL, R15 + MOVL $0x00000001, BP + MOVB R14, CL + SHLL CL, BP + DECL BP + ANDQ BP, R15 + ADDQ R15, DI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(DI*8), DI + + // Update Match Length State + MOVBQZX R8, R14 + SHRQ $0x10, R8 + MOVWQZX R8, R8 + LEAQ (BX)(R14*1), CX + MOVQ DX, R15 + MOVQ CX, BX + ROLQ CL, R15 + MOVL $0x00000001, BP + MOVB R14, CL + SHLL CL, BP + DECL BP + ANDQ BP, R15 + ADDQ R15, R8 + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Offset State + MOVBQZX R9, R14 + SHRQ $0x10, R9 + MOVWQZX R9, R9 + LEAQ (BX)(R14*1), CX + MOVQ DX, R15 + MOVQ CX, BX + ROLQ CL, R15 + MOVL $0x00000001, BP + MOVB R14, CL + SHLL CL, BP + DECL BP + ANDQ BP, R15 + ADDQ R15, R9 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R9*8), R9 + +sequenceDecs_decode_amd64_skip_update: + // Adjust offset + MOVQ 16(R10), CX + CMPQ AX, $0x01 + JBE sequenceDecs_decode_amd64_adjust_offsetB_1_or_0 + MOVQ R12, R13 + MOVQ R11, R12 + MOVQ CX, R11 + JMP sequenceDecs_decode_amd64_after_adjust + +sequenceDecs_decode_amd64_adjust_offsetB_1_or_0: + CMPQ (R10), $0x00000000 + JNE sequenceDecs_decode_amd64_adjust_offset_maybezero + INCQ CX + JMP sequenceDecs_decode_amd64_adjust_offset_nonzero + +sequenceDecs_decode_amd64_adjust_offset_maybezero: + TESTQ CX, CX + JNZ sequenceDecs_decode_amd64_adjust_offset_nonzero + MOVQ R11, CX + JMP sequenceDecs_decode_amd64_after_adjust + +sequenceDecs_decode_amd64_adjust_offset_nonzero: + CMPQ CX, $0x01 + JB sequenceDecs_decode_amd64_adjust_zero + JEQ sequenceDecs_decode_amd64_adjust_one + CMPQ CX, $0x02 + JA sequenceDecs_decode_amd64_adjust_three + JMP sequenceDecs_decode_amd64_adjust_two + +sequenceDecs_decode_amd64_adjust_zero: + MOVQ R11, AX + JMP sequenceDecs_decode_amd64_adjust_test_temp_valid + +sequenceDecs_decode_amd64_adjust_one: + MOVQ R12, AX + JMP sequenceDecs_decode_amd64_adjust_test_temp_valid + +sequenceDecs_decode_amd64_adjust_two: + MOVQ R13, AX + JMP sequenceDecs_decode_amd64_adjust_test_temp_valid + +sequenceDecs_decode_amd64_adjust_three: + LEAQ -1(R11), AX + +sequenceDecs_decode_amd64_adjust_test_temp_valid: + TESTQ AX, AX + JNZ sequenceDecs_decode_amd64_adjust_temp_valid + MOVQ $0x00000001, AX + +sequenceDecs_decode_amd64_adjust_temp_valid: + CMPQ CX, $0x01 + CMOVQNE R12, R13 + MOVQ R11, R12 + MOVQ AX, R11 + MOVQ AX, CX + +sequenceDecs_decode_amd64_after_adjust: + MOVQ CX, 16(R10) + + // Check values + MOVQ 8(R10), AX + MOVQ (R10), R14 + LEAQ (AX)(R14*1), R15 + MOVQ s+0(FP), BP + ADDQ R15, 256(BP) + MOVQ ctx+16(FP), R15 + SUBQ R14, 128(R15) + JS error_not_enough_literals + CMPQ AX, $0x00020002 + JA sequenceDecs_decode_amd64_error_match_len_too_big + TESTQ CX, CX + JNZ sequenceDecs_decode_amd64_match_len_ofs_ok + TESTQ AX, AX + JNZ sequenceDecs_decode_amd64_error_match_len_ofs_mismatch + +sequenceDecs_decode_amd64_match_len_ofs_ok: + ADDQ $0x18, R10 + MOVQ ctx+16(FP), AX + DECQ 96(AX) + JNS sequenceDecs_decode_amd64_main_loop + MOVQ s+0(FP), AX + MOVQ R11, 144(AX) + MOVQ R12, 152(AX) + MOVQ R13, 160(AX) + MOVQ br+8(FP), AX + MOVQ DX, 32(AX) + MOVB BL, 40(AX) + MOVQ SI, 24(AX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decode_amd64_error_match_len_ofs_mismatch: + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decode_amd64_error_match_len_too_big: + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with overread error +error_overread: + MOVQ $0x00000006, ret+24(FP) + RET + +// func sequenceDecs_decode_56_amd64(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int +// Requires: CMOV +TEXT ·sequenceDecs_decode_56_amd64(SB), $8-32 + MOVQ br+8(FP), AX + MOVQ 32(AX), DX + MOVBQZX 40(AX), BX + MOVQ 24(AX), SI + MOVQ (AX), AX + ADDQ SI, AX + MOVQ AX, (SP) + MOVQ ctx+16(FP), AX + MOVQ 72(AX), DI + MOVQ 80(AX), R8 + MOVQ 88(AX), R9 + MOVQ 104(AX), R10 + MOVQ s+0(FP), AX + MOVQ 144(AX), R11 + MOVQ 152(AX), R12 + MOVQ 160(AX), R13 + +sequenceDecs_decode_56_amd64_main_loop: + MOVQ (SP), R14 + + // Fill bitreader to have enough for the offset and match length. + CMPQ SI, $0x08 + JL sequenceDecs_decode_56_amd64_fill_byte_by_byte + MOVQ BX, AX + SHRQ $0x03, AX + SUBQ AX, R14 + MOVQ (R14), DX + SUBQ AX, SI + ANDQ $0x07, BX + JMP sequenceDecs_decode_56_amd64_fill_end + +sequenceDecs_decode_56_amd64_fill_byte_by_byte: + CMPQ SI, $0x00 + JLE sequenceDecs_decode_56_amd64_fill_check_overread + CMPQ BX, $0x07 + JLE sequenceDecs_decode_56_amd64_fill_end + SHLQ $0x08, DX + SUBQ $0x01, R14 + SUBQ $0x01, SI + SUBQ $0x08, BX + MOVBQZX (R14), AX + ORQ AX, DX + JMP sequenceDecs_decode_56_amd64_fill_byte_by_byte + +sequenceDecs_decode_56_amd64_fill_check_overread: + CMPQ BX, $0x40 + JA error_overread + +sequenceDecs_decode_56_amd64_fill_end: + // Update offset + MOVQ R9, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_56_amd64_of_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_56_amd64_of_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_56_amd64_of_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_56_amd64_of_update_zero: + MOVQ AX, 16(R10) + + // Update match length + MOVQ R8, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_56_amd64_ml_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_56_amd64_ml_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_56_amd64_ml_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_56_amd64_ml_update_zero: + MOVQ AX, 8(R10) + + // Update literal length + MOVQ DI, AX + MOVQ BX, CX + MOVQ DX, R15 + SHLQ CL, R15 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decode_56_amd64_ll_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decode_56_amd64_ll_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decode_56_amd64_ll_update_zero + NEGQ CX + SHRQ CL, R15 + ADDQ R15, AX + +sequenceDecs_decode_56_amd64_ll_update_zero: + MOVQ AX, (R10) + + // Fill bitreader for state updates + MOVQ R14, (SP) + MOVQ R9, AX + SHRQ $0x08, AX + MOVBQZX AL, AX + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decode_56_amd64_skip_update + + // Update Literal Length State + MOVBQZX DI, R14 + SHRQ $0x10, DI + MOVWQZX DI, DI + LEAQ (BX)(R14*1), CX + MOVQ DX, R15 + MOVQ CX, BX + ROLQ CL, R15 + MOVL $0x00000001, BP + MOVB R14, CL + SHLL CL, BP + DECL BP + ANDQ BP, R15 + ADDQ R15, DI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(DI*8), DI + + // Update Match Length State + MOVBQZX R8, R14 + SHRQ $0x10, R8 + MOVWQZX R8, R8 + LEAQ (BX)(R14*1), CX + MOVQ DX, R15 + MOVQ CX, BX + ROLQ CL, R15 + MOVL $0x00000001, BP + MOVB R14, CL + SHLL CL, BP + DECL BP + ANDQ BP, R15 + ADDQ R15, R8 + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Offset State + MOVBQZX R9, R14 + SHRQ $0x10, R9 + MOVWQZX R9, R9 + LEAQ (BX)(R14*1), CX + MOVQ DX, R15 + MOVQ CX, BX + ROLQ CL, R15 + MOVL $0x00000001, BP + MOVB R14, CL + SHLL CL, BP + DECL BP + ANDQ BP, R15 + ADDQ R15, R9 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R9*8), R9 + +sequenceDecs_decode_56_amd64_skip_update: + // Adjust offset + MOVQ 16(R10), CX + CMPQ AX, $0x01 + JBE sequenceDecs_decode_56_amd64_adjust_offsetB_1_or_0 + MOVQ R12, R13 + MOVQ R11, R12 + MOVQ CX, R11 + JMP sequenceDecs_decode_56_amd64_after_adjust + +sequenceDecs_decode_56_amd64_adjust_offsetB_1_or_0: + CMPQ (R10), $0x00000000 + JNE sequenceDecs_decode_56_amd64_adjust_offset_maybezero + INCQ CX + JMP sequenceDecs_decode_56_amd64_adjust_offset_nonzero + +sequenceDecs_decode_56_amd64_adjust_offset_maybezero: + TESTQ CX, CX + JNZ sequenceDecs_decode_56_amd64_adjust_offset_nonzero + MOVQ R11, CX + JMP sequenceDecs_decode_56_amd64_after_adjust + +sequenceDecs_decode_56_amd64_adjust_offset_nonzero: + CMPQ CX, $0x01 + JB sequenceDecs_decode_56_amd64_adjust_zero + JEQ sequenceDecs_decode_56_amd64_adjust_one + CMPQ CX, $0x02 + JA sequenceDecs_decode_56_amd64_adjust_three + JMP sequenceDecs_decode_56_amd64_adjust_two + +sequenceDecs_decode_56_amd64_adjust_zero: + MOVQ R11, AX + JMP sequenceDecs_decode_56_amd64_adjust_test_temp_valid + +sequenceDecs_decode_56_amd64_adjust_one: + MOVQ R12, AX + JMP sequenceDecs_decode_56_amd64_adjust_test_temp_valid + +sequenceDecs_decode_56_amd64_adjust_two: + MOVQ R13, AX + JMP sequenceDecs_decode_56_amd64_adjust_test_temp_valid + +sequenceDecs_decode_56_amd64_adjust_three: + LEAQ -1(R11), AX + +sequenceDecs_decode_56_amd64_adjust_test_temp_valid: + TESTQ AX, AX + JNZ sequenceDecs_decode_56_amd64_adjust_temp_valid + MOVQ $0x00000001, AX + +sequenceDecs_decode_56_amd64_adjust_temp_valid: + CMPQ CX, $0x01 + CMOVQNE R12, R13 + MOVQ R11, R12 + MOVQ AX, R11 + MOVQ AX, CX + +sequenceDecs_decode_56_amd64_after_adjust: + MOVQ CX, 16(R10) + + // Check values + MOVQ 8(R10), AX + MOVQ (R10), R14 + LEAQ (AX)(R14*1), R15 + MOVQ s+0(FP), BP + ADDQ R15, 256(BP) + MOVQ ctx+16(FP), R15 + SUBQ R14, 128(R15) + JS error_not_enough_literals + CMPQ AX, $0x00020002 + JA sequenceDecs_decode_56_amd64_error_match_len_too_big + TESTQ CX, CX + JNZ sequenceDecs_decode_56_amd64_match_len_ofs_ok + TESTQ AX, AX + JNZ sequenceDecs_decode_56_amd64_error_match_len_ofs_mismatch + +sequenceDecs_decode_56_amd64_match_len_ofs_ok: + ADDQ $0x18, R10 + MOVQ ctx+16(FP), AX + DECQ 96(AX) + JNS sequenceDecs_decode_56_amd64_main_loop + MOVQ s+0(FP), AX + MOVQ R11, 144(AX) + MOVQ R12, 152(AX) + MOVQ R13, 160(AX) + MOVQ br+8(FP), AX + MOVQ DX, 32(AX) + MOVB BL, 40(AX) + MOVQ SI, 24(AX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decode_56_amd64_error_match_len_ofs_mismatch: + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decode_56_amd64_error_match_len_too_big: + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with overread error +error_overread: + MOVQ $0x00000006, ret+24(FP) + RET + +// func sequenceDecs_decode_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int +// Requires: BMI, BMI2, CMOV +TEXT ·sequenceDecs_decode_bmi2(SB), $8-32 + MOVQ br+8(FP), CX + MOVQ 32(CX), AX + MOVBQZX 40(CX), DX + MOVQ 24(CX), BX + MOVQ (CX), CX + ADDQ BX, CX + MOVQ CX, (SP) + MOVQ ctx+16(FP), CX + MOVQ 72(CX), SI + MOVQ 80(CX), DI + MOVQ 88(CX), R8 + MOVQ 104(CX), R9 + MOVQ s+0(FP), CX + MOVQ 144(CX), R10 + MOVQ 152(CX), R11 + MOVQ 160(CX), R12 + +sequenceDecs_decode_bmi2_main_loop: + MOVQ (SP), R13 + + // Fill bitreader to have enough for the offset and match length. + CMPQ BX, $0x08 + JL sequenceDecs_decode_bmi2_fill_byte_by_byte + MOVQ DX, CX + SHRQ $0x03, CX + SUBQ CX, R13 + MOVQ (R13), AX + SUBQ CX, BX + ANDQ $0x07, DX + JMP sequenceDecs_decode_bmi2_fill_end + +sequenceDecs_decode_bmi2_fill_byte_by_byte: + CMPQ BX, $0x00 + JLE sequenceDecs_decode_bmi2_fill_check_overread + CMPQ DX, $0x07 + JLE sequenceDecs_decode_bmi2_fill_end + SHLQ $0x08, AX + SUBQ $0x01, R13 + SUBQ $0x01, BX + SUBQ $0x08, DX + MOVBQZX (R13), CX + ORQ CX, AX + JMP sequenceDecs_decode_bmi2_fill_byte_by_byte + +sequenceDecs_decode_bmi2_fill_check_overread: + CMPQ DX, $0x40 + JA error_overread + +sequenceDecs_decode_bmi2_fill_end: + // Update offset + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R14 + MOVQ AX, R15 + LEAQ (DX)(R14*1), CX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + MOVQ CX, DX + MOVQ R8, CX + SHRQ $0x20, CX + ADDQ R15, CX + MOVQ CX, 16(R9) + + // Update match length + MOVQ $0x00000808, CX + BEXTRQ CX, DI, R14 + MOVQ AX, R15 + LEAQ (DX)(R14*1), CX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + MOVQ CX, DX + MOVQ DI, CX + SHRQ $0x20, CX + ADDQ R15, CX + MOVQ CX, 8(R9) + + // Fill bitreader to have enough for the remaining + CMPQ BX, $0x08 + JL sequenceDecs_decode_bmi2_fill_2_byte_by_byte + MOVQ DX, CX + SHRQ $0x03, CX + SUBQ CX, R13 + MOVQ (R13), AX + SUBQ CX, BX + ANDQ $0x07, DX + JMP sequenceDecs_decode_bmi2_fill_2_end + +sequenceDecs_decode_bmi2_fill_2_byte_by_byte: + CMPQ BX, $0x00 + JLE sequenceDecs_decode_bmi2_fill_2_check_overread + CMPQ DX, $0x07 + JLE sequenceDecs_decode_bmi2_fill_2_end + SHLQ $0x08, AX + SUBQ $0x01, R13 + SUBQ $0x01, BX + SUBQ $0x08, DX + MOVBQZX (R13), CX + ORQ CX, AX + JMP sequenceDecs_decode_bmi2_fill_2_byte_by_byte + +sequenceDecs_decode_bmi2_fill_2_check_overread: + CMPQ DX, $0x40 + JA error_overread + +sequenceDecs_decode_bmi2_fill_2_end: + // Update literal length + MOVQ $0x00000808, CX + BEXTRQ CX, SI, R14 + MOVQ AX, R15 + LEAQ (DX)(R14*1), CX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + MOVQ CX, DX + MOVQ SI, CX + SHRQ $0x20, CX + ADDQ R15, CX + MOVQ CX, (R9) + + // Fill bitreader for state updates + MOVQ R13, (SP) + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R13 + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decode_bmi2_skip_update + LEAQ (SI)(DI*1), R14 + ADDQ R8, R14 + MOVBQZX R14, R14 + LEAQ (DX)(R14*1), CX + MOVQ AX, R15 + MOVQ CX, DX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + + // Update Offset State + BZHIQ R8, R15, CX + SHRXQ R8, R15, R15 + MOVQ $0x00001010, R14 + BEXTRQ R14, R8, R8 + ADDQ CX, R8 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Match Length State + BZHIQ DI, R15, CX + SHRXQ DI, R15, R15 + MOVQ $0x00001010, R14 + BEXTRQ R14, DI, DI + ADDQ CX, DI + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(DI*8), DI + + // Update Literal Length State + BZHIQ SI, R15, CX + MOVQ $0x00001010, R14 + BEXTRQ R14, SI, SI + ADDQ CX, SI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(SI*8), SI + +sequenceDecs_decode_bmi2_skip_update: + // Adjust offset + MOVQ 16(R9), CX + CMPQ R13, $0x01 + JBE sequenceDecs_decode_bmi2_adjust_offsetB_1_or_0 + MOVQ R11, R12 + MOVQ R10, R11 + MOVQ CX, R10 + JMP sequenceDecs_decode_bmi2_after_adjust + +sequenceDecs_decode_bmi2_adjust_offsetB_1_or_0: + CMPQ (R9), $0x00000000 + JNE sequenceDecs_decode_bmi2_adjust_offset_maybezero + INCQ CX + JMP sequenceDecs_decode_bmi2_adjust_offset_nonzero + +sequenceDecs_decode_bmi2_adjust_offset_maybezero: + TESTQ CX, CX + JNZ sequenceDecs_decode_bmi2_adjust_offset_nonzero + MOVQ R10, CX + JMP sequenceDecs_decode_bmi2_after_adjust + +sequenceDecs_decode_bmi2_adjust_offset_nonzero: + CMPQ CX, $0x01 + JB sequenceDecs_decode_bmi2_adjust_zero + JEQ sequenceDecs_decode_bmi2_adjust_one + CMPQ CX, $0x02 + JA sequenceDecs_decode_bmi2_adjust_three + JMP sequenceDecs_decode_bmi2_adjust_two + +sequenceDecs_decode_bmi2_adjust_zero: + MOVQ R10, R13 + JMP sequenceDecs_decode_bmi2_adjust_test_temp_valid + +sequenceDecs_decode_bmi2_adjust_one: + MOVQ R11, R13 + JMP sequenceDecs_decode_bmi2_adjust_test_temp_valid + +sequenceDecs_decode_bmi2_adjust_two: + MOVQ R12, R13 + JMP sequenceDecs_decode_bmi2_adjust_test_temp_valid + +sequenceDecs_decode_bmi2_adjust_three: + LEAQ -1(R10), R13 + +sequenceDecs_decode_bmi2_adjust_test_temp_valid: + TESTQ R13, R13 + JNZ sequenceDecs_decode_bmi2_adjust_temp_valid + MOVQ $0x00000001, R13 + +sequenceDecs_decode_bmi2_adjust_temp_valid: + CMPQ CX, $0x01 + CMOVQNE R11, R12 + MOVQ R10, R11 + MOVQ R13, R10 + MOVQ R13, CX + +sequenceDecs_decode_bmi2_after_adjust: + MOVQ CX, 16(R9) + + // Check values + MOVQ 8(R9), R13 + MOVQ (R9), R14 + LEAQ (R13)(R14*1), R15 + MOVQ s+0(FP), BP + ADDQ R15, 256(BP) + MOVQ ctx+16(FP), R15 + SUBQ R14, 128(R15) + JS error_not_enough_literals + CMPQ R13, $0x00020002 + JA sequenceDecs_decode_bmi2_error_match_len_too_big + TESTQ CX, CX + JNZ sequenceDecs_decode_bmi2_match_len_ofs_ok + TESTQ R13, R13 + JNZ sequenceDecs_decode_bmi2_error_match_len_ofs_mismatch + +sequenceDecs_decode_bmi2_match_len_ofs_ok: + ADDQ $0x18, R9 + MOVQ ctx+16(FP), CX + DECQ 96(CX) + JNS sequenceDecs_decode_bmi2_main_loop + MOVQ s+0(FP), CX + MOVQ R10, 144(CX) + MOVQ R11, 152(CX) + MOVQ R12, 160(CX) + MOVQ br+8(FP), CX + MOVQ AX, 32(CX) + MOVB DL, 40(CX) + MOVQ BX, 24(CX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decode_bmi2_error_match_len_ofs_mismatch: + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decode_bmi2_error_match_len_too_big: + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with overread error +error_overread: + MOVQ $0x00000006, ret+24(FP) + RET + +// func sequenceDecs_decode_56_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeAsmContext) int +// Requires: BMI, BMI2, CMOV +TEXT ·sequenceDecs_decode_56_bmi2(SB), $8-32 + MOVQ br+8(FP), CX + MOVQ 32(CX), AX + MOVBQZX 40(CX), DX + MOVQ 24(CX), BX + MOVQ (CX), CX + ADDQ BX, CX + MOVQ CX, (SP) + MOVQ ctx+16(FP), CX + MOVQ 72(CX), SI + MOVQ 80(CX), DI + MOVQ 88(CX), R8 + MOVQ 104(CX), R9 + MOVQ s+0(FP), CX + MOVQ 144(CX), R10 + MOVQ 152(CX), R11 + MOVQ 160(CX), R12 + +sequenceDecs_decode_56_bmi2_main_loop: + MOVQ (SP), R13 + + // Fill bitreader to have enough for the offset and match length. + CMPQ BX, $0x08 + JL sequenceDecs_decode_56_bmi2_fill_byte_by_byte + MOVQ DX, CX + SHRQ $0x03, CX + SUBQ CX, R13 + MOVQ (R13), AX + SUBQ CX, BX + ANDQ $0x07, DX + JMP sequenceDecs_decode_56_bmi2_fill_end + +sequenceDecs_decode_56_bmi2_fill_byte_by_byte: + CMPQ BX, $0x00 + JLE sequenceDecs_decode_56_bmi2_fill_check_overread + CMPQ DX, $0x07 + JLE sequenceDecs_decode_56_bmi2_fill_end + SHLQ $0x08, AX + SUBQ $0x01, R13 + SUBQ $0x01, BX + SUBQ $0x08, DX + MOVBQZX (R13), CX + ORQ CX, AX + JMP sequenceDecs_decode_56_bmi2_fill_byte_by_byte + +sequenceDecs_decode_56_bmi2_fill_check_overread: + CMPQ DX, $0x40 + JA error_overread + +sequenceDecs_decode_56_bmi2_fill_end: + // Update offset + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R14 + MOVQ AX, R15 + LEAQ (DX)(R14*1), CX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + MOVQ CX, DX + MOVQ R8, CX + SHRQ $0x20, CX + ADDQ R15, CX + MOVQ CX, 16(R9) + + // Update match length + MOVQ $0x00000808, CX + BEXTRQ CX, DI, R14 + MOVQ AX, R15 + LEAQ (DX)(R14*1), CX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + MOVQ CX, DX + MOVQ DI, CX + SHRQ $0x20, CX + ADDQ R15, CX + MOVQ CX, 8(R9) + + // Update literal length + MOVQ $0x00000808, CX + BEXTRQ CX, SI, R14 + MOVQ AX, R15 + LEAQ (DX)(R14*1), CX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + MOVQ CX, DX + MOVQ SI, CX + SHRQ $0x20, CX + ADDQ R15, CX + MOVQ CX, (R9) + + // Fill bitreader for state updates + MOVQ R13, (SP) + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R13 + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decode_56_bmi2_skip_update + LEAQ (SI)(DI*1), R14 + ADDQ R8, R14 + MOVBQZX R14, R14 + LEAQ (DX)(R14*1), CX + MOVQ AX, R15 + MOVQ CX, DX + ROLQ CL, R15 + BZHIQ R14, R15, R15 + + // Update Offset State + BZHIQ R8, R15, CX + SHRXQ R8, R15, R15 + MOVQ $0x00001010, R14 + BEXTRQ R14, R8, R8 + ADDQ CX, R8 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Match Length State + BZHIQ DI, R15, CX + SHRXQ DI, R15, R15 + MOVQ $0x00001010, R14 + BEXTRQ R14, DI, DI + ADDQ CX, DI + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(DI*8), DI + + // Update Literal Length State + BZHIQ SI, R15, CX + MOVQ $0x00001010, R14 + BEXTRQ R14, SI, SI + ADDQ CX, SI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(SI*8), SI + +sequenceDecs_decode_56_bmi2_skip_update: + // Adjust offset + MOVQ 16(R9), CX + CMPQ R13, $0x01 + JBE sequenceDecs_decode_56_bmi2_adjust_offsetB_1_or_0 + MOVQ R11, R12 + MOVQ R10, R11 + MOVQ CX, R10 + JMP sequenceDecs_decode_56_bmi2_after_adjust + +sequenceDecs_decode_56_bmi2_adjust_offsetB_1_or_0: + CMPQ (R9), $0x00000000 + JNE sequenceDecs_decode_56_bmi2_adjust_offset_maybezero + INCQ CX + JMP sequenceDecs_decode_56_bmi2_adjust_offset_nonzero + +sequenceDecs_decode_56_bmi2_adjust_offset_maybezero: + TESTQ CX, CX + JNZ sequenceDecs_decode_56_bmi2_adjust_offset_nonzero + MOVQ R10, CX + JMP sequenceDecs_decode_56_bmi2_after_adjust + +sequenceDecs_decode_56_bmi2_adjust_offset_nonzero: + CMPQ CX, $0x01 + JB sequenceDecs_decode_56_bmi2_adjust_zero + JEQ sequenceDecs_decode_56_bmi2_adjust_one + CMPQ CX, $0x02 + JA sequenceDecs_decode_56_bmi2_adjust_three + JMP sequenceDecs_decode_56_bmi2_adjust_two + +sequenceDecs_decode_56_bmi2_adjust_zero: + MOVQ R10, R13 + JMP sequenceDecs_decode_56_bmi2_adjust_test_temp_valid + +sequenceDecs_decode_56_bmi2_adjust_one: + MOVQ R11, R13 + JMP sequenceDecs_decode_56_bmi2_adjust_test_temp_valid + +sequenceDecs_decode_56_bmi2_adjust_two: + MOVQ R12, R13 + JMP sequenceDecs_decode_56_bmi2_adjust_test_temp_valid + +sequenceDecs_decode_56_bmi2_adjust_three: + LEAQ -1(R10), R13 + +sequenceDecs_decode_56_bmi2_adjust_test_temp_valid: + TESTQ R13, R13 + JNZ sequenceDecs_decode_56_bmi2_adjust_temp_valid + MOVQ $0x00000001, R13 + +sequenceDecs_decode_56_bmi2_adjust_temp_valid: + CMPQ CX, $0x01 + CMOVQNE R11, R12 + MOVQ R10, R11 + MOVQ R13, R10 + MOVQ R13, CX + +sequenceDecs_decode_56_bmi2_after_adjust: + MOVQ CX, 16(R9) + + // Check values + MOVQ 8(R9), R13 + MOVQ (R9), R14 + LEAQ (R13)(R14*1), R15 + MOVQ s+0(FP), BP + ADDQ R15, 256(BP) + MOVQ ctx+16(FP), R15 + SUBQ R14, 128(R15) + JS error_not_enough_literals + CMPQ R13, $0x00020002 + JA sequenceDecs_decode_56_bmi2_error_match_len_too_big + TESTQ CX, CX + JNZ sequenceDecs_decode_56_bmi2_match_len_ofs_ok + TESTQ R13, R13 + JNZ sequenceDecs_decode_56_bmi2_error_match_len_ofs_mismatch + +sequenceDecs_decode_56_bmi2_match_len_ofs_ok: + ADDQ $0x18, R9 + MOVQ ctx+16(FP), CX + DECQ 96(CX) + JNS sequenceDecs_decode_56_bmi2_main_loop + MOVQ s+0(FP), CX + MOVQ R10, 144(CX) + MOVQ R11, 152(CX) + MOVQ R12, 160(CX) + MOVQ br+8(FP), CX + MOVQ AX, 32(CX) + MOVB DL, 40(CX) + MOVQ BX, 24(CX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decode_56_bmi2_error_match_len_ofs_mismatch: + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decode_56_bmi2_error_match_len_too_big: + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with overread error +error_overread: + MOVQ $0x00000006, ret+24(FP) + RET + +// func sequenceDecs_executeSimple_amd64(ctx *executeAsmContext) bool +// Requires: SSE +TEXT ·sequenceDecs_executeSimple_amd64(SB), $8-9 + MOVQ ctx+0(FP), R10 + MOVQ 8(R10), CX + TESTQ CX, CX + JZ empty_seqs + MOVQ (R10), AX + MOVQ 24(R10), DX + MOVQ 32(R10), BX + MOVQ 80(R10), SI + MOVQ 104(R10), DI + MOVQ 120(R10), R8 + MOVQ 56(R10), R9 + MOVQ 64(R10), R10 + ADDQ R10, R9 + + // seqsBase += 24 * seqIndex + LEAQ (DX)(DX*2), R11 + SHLQ $0x03, R11 + ADDQ R11, AX + + // outBase += outPosition + ADDQ DI, BX + +main_loop: + MOVQ (AX), R11 + MOVQ 16(AX), R12 + MOVQ 8(AX), R13 + + // Copy literals + TESTQ R11, R11 + JZ check_offset + XORQ R14, R14 + +copy_1: + MOVUPS (SI)(R14*1), X0 + MOVUPS X0, (BX)(R14*1) + ADDQ $0x10, R14 + CMPQ R14, R11 + JB copy_1 + ADDQ R11, SI + ADDQ R11, BX + ADDQ R11, DI + + // Malformed input if seq.mo > t+len(hist) || seq.mo > s.windowSize) +check_offset: + LEAQ (DI)(R10*1), R11 + CMPQ R12, R11 + JG error_match_off_too_big + CMPQ R12, R8 + JG error_match_off_too_big + + // Copy match from history + MOVQ R12, R11 + SUBQ DI, R11 + JLS copy_match + MOVQ R9, R14 + SUBQ R11, R14 + CMPQ R13, R11 + JG copy_all_from_history + MOVQ R13, R11 + SUBQ $0x10, R11 + JB copy_4_small + +copy_4_loop: + MOVUPS (R14), X0 + MOVUPS X0, (BX) + ADDQ $0x10, R14 + ADDQ $0x10, BX + SUBQ $0x10, R11 + JAE copy_4_loop + LEAQ 16(R14)(R11*1), R14 + LEAQ 16(BX)(R11*1), BX + MOVUPS -16(R14), X0 + MOVUPS X0, -16(BX) + JMP copy_4_end + +copy_4_small: + CMPQ R13, $0x03 + JE copy_4_move_3 + CMPQ R13, $0x08 + JB copy_4_move_4through7 + JMP copy_4_move_8through16 + +copy_4_move_3: + MOVW (R14), R11 + MOVB 2(R14), R12 + MOVW R11, (BX) + MOVB R12, 2(BX) + ADDQ R13, R14 + ADDQ R13, BX + JMP copy_4_end + +copy_4_move_4through7: + MOVL (R14), R11 + MOVL -4(R14)(R13*1), R12 + MOVL R11, (BX) + MOVL R12, -4(BX)(R13*1) + ADDQ R13, R14 + ADDQ R13, BX + JMP copy_4_end + +copy_4_move_8through16: + MOVQ (R14), R11 + MOVQ -8(R14)(R13*1), R12 + MOVQ R11, (BX) + MOVQ R12, -8(BX)(R13*1) + ADDQ R13, R14 + ADDQ R13, BX + +copy_4_end: + ADDQ R13, DI + ADDQ $0x18, AX + INCQ DX + CMPQ DX, CX + JB main_loop + JMP loop_finished + +copy_all_from_history: + MOVQ R11, R15 + SUBQ $0x10, R15 + JB copy_5_small + +copy_5_loop: + MOVUPS (R14), X0 + MOVUPS X0, (BX) + ADDQ $0x10, R14 + ADDQ $0x10, BX + SUBQ $0x10, R15 + JAE copy_5_loop + LEAQ 16(R14)(R15*1), R14 + LEAQ 16(BX)(R15*1), BX + MOVUPS -16(R14), X0 + MOVUPS X0, -16(BX) + JMP copy_5_end + +copy_5_small: + CMPQ R11, $0x03 + JE copy_5_move_3 + JB copy_5_move_1or2 + CMPQ R11, $0x08 + JB copy_5_move_4through7 + JMP copy_5_move_8through16 + +copy_5_move_1or2: + MOVB (R14), R15 + MOVB -1(R14)(R11*1), BP + MOVB R15, (BX) + MOVB BP, -1(BX)(R11*1) + ADDQ R11, R14 + ADDQ R11, BX + JMP copy_5_end + +copy_5_move_3: + MOVW (R14), R15 + MOVB 2(R14), BP + MOVW R15, (BX) + MOVB BP, 2(BX) + ADDQ R11, R14 + ADDQ R11, BX + JMP copy_5_end + +copy_5_move_4through7: + MOVL (R14), R15 + MOVL -4(R14)(R11*1), BP + MOVL R15, (BX) + MOVL BP, -4(BX)(R11*1) + ADDQ R11, R14 + ADDQ R11, BX + JMP copy_5_end + +copy_5_move_8through16: + MOVQ (R14), R15 + MOVQ -8(R14)(R11*1), BP + MOVQ R15, (BX) + MOVQ BP, -8(BX)(R11*1) + ADDQ R11, R14 + ADDQ R11, BX + +copy_5_end: + ADDQ R11, DI + SUBQ R11, R13 + + // Copy match from the current buffer +copy_match: + MOVQ BX, R11 + SUBQ R12, R11 + + // ml <= mo + CMPQ R13, R12 + JA copy_overlapping_match + + // Copy non-overlapping match + ADDQ R13, DI + MOVQ BX, R12 + ADDQ R13, BX + +copy_2: + MOVUPS (R11), X0 + MOVUPS X0, (R12) + ADDQ $0x10, R11 + ADDQ $0x10, R12 + SUBQ $0x10, R13 + JHI copy_2 + JMP handle_loop + + // Copy overlapping match +copy_overlapping_match: + ADDQ R13, DI + +copy_slow_3: + MOVB (R11), R12 + MOVB R12, (BX) + INCQ R11 + INCQ BX + DECQ R13 + JNZ copy_slow_3 + +handle_loop: + ADDQ $0x18, AX + INCQ DX + CMPQ DX, CX + JB main_loop + +loop_finished: + // Return value + MOVB $0x01, ret+8(FP) + + // Update the context + MOVQ ctx+0(FP), AX + MOVQ DX, 24(AX) + MOVQ DI, 104(AX) + SUBQ 80(AX), SI + MOVQ SI, 112(AX) + RET + +error_match_off_too_big: + // Return value + MOVB $0x00, ret+8(FP) + + // Update the context + MOVQ ctx+0(FP), AX + MOVQ DX, 24(AX) + MOVQ DI, 104(AX) + SUBQ 80(AX), SI + MOVQ SI, 112(AX) + RET + +empty_seqs: + // Return value + MOVB $0x01, ret+8(FP) + RET + +// func sequenceDecs_executeSimple_safe_amd64(ctx *executeAsmContext) bool +// Requires: SSE +TEXT ·sequenceDecs_executeSimple_safe_amd64(SB), $8-9 + MOVQ ctx+0(FP), R10 + MOVQ 8(R10), CX + TESTQ CX, CX + JZ empty_seqs + MOVQ (R10), AX + MOVQ 24(R10), DX + MOVQ 32(R10), BX + MOVQ 80(R10), SI + MOVQ 104(R10), DI + MOVQ 120(R10), R8 + MOVQ 56(R10), R9 + MOVQ 64(R10), R10 + ADDQ R10, R9 + + // seqsBase += 24 * seqIndex + LEAQ (DX)(DX*2), R11 + SHLQ $0x03, R11 + ADDQ R11, AX + + // outBase += outPosition + ADDQ DI, BX + +main_loop: + MOVQ (AX), R11 + MOVQ 16(AX), R12 + MOVQ 8(AX), R13 + + // Copy literals + TESTQ R11, R11 + JZ check_offset + MOVQ R11, R14 + SUBQ $0x10, R14 + JB copy_1_small + +copy_1_loop: + MOVUPS (SI), X0 + MOVUPS X0, (BX) + ADDQ $0x10, SI + ADDQ $0x10, BX + SUBQ $0x10, R14 + JAE copy_1_loop + LEAQ 16(SI)(R14*1), SI + LEAQ 16(BX)(R14*1), BX + MOVUPS -16(SI), X0 + MOVUPS X0, -16(BX) + JMP copy_1_end + +copy_1_small: + CMPQ R11, $0x03 + JE copy_1_move_3 + JB copy_1_move_1or2 + CMPQ R11, $0x08 + JB copy_1_move_4through7 + JMP copy_1_move_8through16 + +copy_1_move_1or2: + MOVB (SI), R14 + MOVB -1(SI)(R11*1), R15 + MOVB R14, (BX) + MOVB R15, -1(BX)(R11*1) + ADDQ R11, SI + ADDQ R11, BX + JMP copy_1_end + +copy_1_move_3: + MOVW (SI), R14 + MOVB 2(SI), R15 + MOVW R14, (BX) + MOVB R15, 2(BX) + ADDQ R11, SI + ADDQ R11, BX + JMP copy_1_end + +copy_1_move_4through7: + MOVL (SI), R14 + MOVL -4(SI)(R11*1), R15 + MOVL R14, (BX) + MOVL R15, -4(BX)(R11*1) + ADDQ R11, SI + ADDQ R11, BX + JMP copy_1_end + +copy_1_move_8through16: + MOVQ (SI), R14 + MOVQ -8(SI)(R11*1), R15 + MOVQ R14, (BX) + MOVQ R15, -8(BX)(R11*1) + ADDQ R11, SI + ADDQ R11, BX + +copy_1_end: + ADDQ R11, DI + + // Malformed input if seq.mo > t+len(hist) || seq.mo > s.windowSize) +check_offset: + LEAQ (DI)(R10*1), R11 + CMPQ R12, R11 + JG error_match_off_too_big + CMPQ R12, R8 + JG error_match_off_too_big + + // Copy match from history + MOVQ R12, R11 + SUBQ DI, R11 + JLS copy_match + MOVQ R9, R14 + SUBQ R11, R14 + CMPQ R13, R11 + JG copy_all_from_history + MOVQ R13, R11 + SUBQ $0x10, R11 + JB copy_4_small + +copy_4_loop: + MOVUPS (R14), X0 + MOVUPS X0, (BX) + ADDQ $0x10, R14 + ADDQ $0x10, BX + SUBQ $0x10, R11 + JAE copy_4_loop + LEAQ 16(R14)(R11*1), R14 + LEAQ 16(BX)(R11*1), BX + MOVUPS -16(R14), X0 + MOVUPS X0, -16(BX) + JMP copy_4_end + +copy_4_small: + CMPQ R13, $0x03 + JE copy_4_move_3 + CMPQ R13, $0x08 + JB copy_4_move_4through7 + JMP copy_4_move_8through16 + +copy_4_move_3: + MOVW (R14), R11 + MOVB 2(R14), R12 + MOVW R11, (BX) + MOVB R12, 2(BX) + ADDQ R13, R14 + ADDQ R13, BX + JMP copy_4_end + +copy_4_move_4through7: + MOVL (R14), R11 + MOVL -4(R14)(R13*1), R12 + MOVL R11, (BX) + MOVL R12, -4(BX)(R13*1) + ADDQ R13, R14 + ADDQ R13, BX + JMP copy_4_end + +copy_4_move_8through16: + MOVQ (R14), R11 + MOVQ -8(R14)(R13*1), R12 + MOVQ R11, (BX) + MOVQ R12, -8(BX)(R13*1) + ADDQ R13, R14 + ADDQ R13, BX + +copy_4_end: + ADDQ R13, DI + ADDQ $0x18, AX + INCQ DX + CMPQ DX, CX + JB main_loop + JMP loop_finished + +copy_all_from_history: + MOVQ R11, R15 + SUBQ $0x10, R15 + JB copy_5_small + +copy_5_loop: + MOVUPS (R14), X0 + MOVUPS X0, (BX) + ADDQ $0x10, R14 + ADDQ $0x10, BX + SUBQ $0x10, R15 + JAE copy_5_loop + LEAQ 16(R14)(R15*1), R14 + LEAQ 16(BX)(R15*1), BX + MOVUPS -16(R14), X0 + MOVUPS X0, -16(BX) + JMP copy_5_end + +copy_5_small: + CMPQ R11, $0x03 + JE copy_5_move_3 + JB copy_5_move_1or2 + CMPQ R11, $0x08 + JB copy_5_move_4through7 + JMP copy_5_move_8through16 + +copy_5_move_1or2: + MOVB (R14), R15 + MOVB -1(R14)(R11*1), BP + MOVB R15, (BX) + MOVB BP, -1(BX)(R11*1) + ADDQ R11, R14 + ADDQ R11, BX + JMP copy_5_end + +copy_5_move_3: + MOVW (R14), R15 + MOVB 2(R14), BP + MOVW R15, (BX) + MOVB BP, 2(BX) + ADDQ R11, R14 + ADDQ R11, BX + JMP copy_5_end + +copy_5_move_4through7: + MOVL (R14), R15 + MOVL -4(R14)(R11*1), BP + MOVL R15, (BX) + MOVL BP, -4(BX)(R11*1) + ADDQ R11, R14 + ADDQ R11, BX + JMP copy_5_end + +copy_5_move_8through16: + MOVQ (R14), R15 + MOVQ -8(R14)(R11*1), BP + MOVQ R15, (BX) + MOVQ BP, -8(BX)(R11*1) + ADDQ R11, R14 + ADDQ R11, BX + +copy_5_end: + ADDQ R11, DI + SUBQ R11, R13 + + // Copy match from the current buffer +copy_match: + MOVQ BX, R11 + SUBQ R12, R11 + + // ml <= mo + CMPQ R13, R12 + JA copy_overlapping_match + + // Copy non-overlapping match + ADDQ R13, DI + MOVQ R13, R12 + SUBQ $0x10, R12 + JB copy_2_small + +copy_2_loop: + MOVUPS (R11), X0 + MOVUPS X0, (BX) + ADDQ $0x10, R11 + ADDQ $0x10, BX + SUBQ $0x10, R12 + JAE copy_2_loop + LEAQ 16(R11)(R12*1), R11 + LEAQ 16(BX)(R12*1), BX + MOVUPS -16(R11), X0 + MOVUPS X0, -16(BX) + JMP copy_2_end + +copy_2_small: + CMPQ R13, $0x03 + JE copy_2_move_3 + JB copy_2_move_1or2 + CMPQ R13, $0x08 + JB copy_2_move_4through7 + JMP copy_2_move_8through16 + +copy_2_move_1or2: + MOVB (R11), R12 + MOVB -1(R11)(R13*1), R14 + MOVB R12, (BX) + MOVB R14, -1(BX)(R13*1) + ADDQ R13, R11 + ADDQ R13, BX + JMP copy_2_end + +copy_2_move_3: + MOVW (R11), R12 + MOVB 2(R11), R14 + MOVW R12, (BX) + MOVB R14, 2(BX) + ADDQ R13, R11 + ADDQ R13, BX + JMP copy_2_end + +copy_2_move_4through7: + MOVL (R11), R12 + MOVL -4(R11)(R13*1), R14 + MOVL R12, (BX) + MOVL R14, -4(BX)(R13*1) + ADDQ R13, R11 + ADDQ R13, BX + JMP copy_2_end + +copy_2_move_8through16: + MOVQ (R11), R12 + MOVQ -8(R11)(R13*1), R14 + MOVQ R12, (BX) + MOVQ R14, -8(BX)(R13*1) + ADDQ R13, R11 + ADDQ R13, BX + +copy_2_end: + JMP handle_loop + + // Copy overlapping match +copy_overlapping_match: + ADDQ R13, DI + +copy_slow_3: + MOVB (R11), R12 + MOVB R12, (BX) + INCQ R11 + INCQ BX + DECQ R13 + JNZ copy_slow_3 + +handle_loop: + ADDQ $0x18, AX + INCQ DX + CMPQ DX, CX + JB main_loop + +loop_finished: + // Return value + MOVB $0x01, ret+8(FP) + + // Update the context + MOVQ ctx+0(FP), AX + MOVQ DX, 24(AX) + MOVQ DI, 104(AX) + SUBQ 80(AX), SI + MOVQ SI, 112(AX) + RET + +error_match_off_too_big: + // Return value + MOVB $0x00, ret+8(FP) + + // Update the context + MOVQ ctx+0(FP), AX + MOVQ DX, 24(AX) + MOVQ DI, 104(AX) + SUBQ 80(AX), SI + MOVQ SI, 112(AX) + RET + +empty_seqs: + // Return value + MOVB $0x01, ret+8(FP) + RET + +// func sequenceDecs_decodeSync_amd64(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int +// Requires: CMOV, SSE +TEXT ·sequenceDecs_decodeSync_amd64(SB), $64-32 + MOVQ br+8(FP), AX + MOVQ 32(AX), DX + MOVBQZX 40(AX), BX + MOVQ 24(AX), SI + MOVQ (AX), AX + ADDQ SI, AX + MOVQ AX, (SP) + MOVQ ctx+16(FP), AX + MOVQ 72(AX), DI + MOVQ 80(AX), R8 + MOVQ 88(AX), R9 + XORQ CX, CX + MOVQ CX, 8(SP) + MOVQ CX, 16(SP) + MOVQ CX, 24(SP) + MOVQ 112(AX), R10 + MOVQ 128(AX), CX + MOVQ CX, 32(SP) + MOVQ 144(AX), R11 + MOVQ 136(AX), R12 + MOVQ 200(AX), CX + MOVQ CX, 56(SP) + MOVQ 176(AX), CX + MOVQ CX, 48(SP) + MOVQ 184(AX), AX + MOVQ AX, 40(SP) + MOVQ 40(SP), AX + ADDQ AX, 48(SP) + + // Calculate poiter to s.out[cap(s.out)] (a past-end pointer) + ADDQ R10, 32(SP) + + // outBase += outPosition + ADDQ R12, R10 + +sequenceDecs_decodeSync_amd64_main_loop: + MOVQ (SP), R13 + + // Fill bitreader to have enough for the offset and match length. + CMPQ SI, $0x08 + JL sequenceDecs_decodeSync_amd64_fill_byte_by_byte + MOVQ BX, AX + SHRQ $0x03, AX + SUBQ AX, R13 + MOVQ (R13), DX + SUBQ AX, SI + ANDQ $0x07, BX + JMP sequenceDecs_decodeSync_amd64_fill_end + +sequenceDecs_decodeSync_amd64_fill_byte_by_byte: + CMPQ SI, $0x00 + JLE sequenceDecs_decodeSync_amd64_fill_check_overread + CMPQ BX, $0x07 + JLE sequenceDecs_decodeSync_amd64_fill_end + SHLQ $0x08, DX + SUBQ $0x01, R13 + SUBQ $0x01, SI + SUBQ $0x08, BX + MOVBQZX (R13), AX + ORQ AX, DX + JMP sequenceDecs_decodeSync_amd64_fill_byte_by_byte + +sequenceDecs_decodeSync_amd64_fill_check_overread: + CMPQ BX, $0x40 + JA error_overread + +sequenceDecs_decodeSync_amd64_fill_end: + // Update offset + MOVQ R9, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_amd64_of_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_amd64_of_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_amd64_of_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_amd64_of_update_zero: + MOVQ AX, 8(SP) + + // Update match length + MOVQ R8, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_amd64_ml_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_amd64_ml_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_amd64_ml_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_amd64_ml_update_zero: + MOVQ AX, 16(SP) + + // Fill bitreader to have enough for the remaining + CMPQ SI, $0x08 + JL sequenceDecs_decodeSync_amd64_fill_2_byte_by_byte + MOVQ BX, AX + SHRQ $0x03, AX + SUBQ AX, R13 + MOVQ (R13), DX + SUBQ AX, SI + ANDQ $0x07, BX + JMP sequenceDecs_decodeSync_amd64_fill_2_end + +sequenceDecs_decodeSync_amd64_fill_2_byte_by_byte: + CMPQ SI, $0x00 + JLE sequenceDecs_decodeSync_amd64_fill_2_check_overread + CMPQ BX, $0x07 + JLE sequenceDecs_decodeSync_amd64_fill_2_end + SHLQ $0x08, DX + SUBQ $0x01, R13 + SUBQ $0x01, SI + SUBQ $0x08, BX + MOVBQZX (R13), AX + ORQ AX, DX + JMP sequenceDecs_decodeSync_amd64_fill_2_byte_by_byte + +sequenceDecs_decodeSync_amd64_fill_2_check_overread: + CMPQ BX, $0x40 + JA error_overread + +sequenceDecs_decodeSync_amd64_fill_2_end: + // Update literal length + MOVQ DI, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_amd64_ll_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_amd64_ll_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_amd64_ll_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_amd64_ll_update_zero: + MOVQ AX, 24(SP) + + // Fill bitreader for state updates + MOVQ R13, (SP) + MOVQ R9, AX + SHRQ $0x08, AX + MOVBQZX AL, AX + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decodeSync_amd64_skip_update + + // Update Literal Length State + MOVBQZX DI, R13 + SHRQ $0x10, DI + MOVWQZX DI, DI + LEAQ (BX)(R13*1), CX + MOVQ DX, R14 + MOVQ CX, BX + ROLQ CL, R14 + MOVL $0x00000001, R15 + MOVB R13, CL + SHLL CL, R15 + DECL R15 + ANDQ R15, R14 + ADDQ R14, DI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(DI*8), DI + + // Update Match Length State + MOVBQZX R8, R13 + SHRQ $0x10, R8 + MOVWQZX R8, R8 + LEAQ (BX)(R13*1), CX + MOVQ DX, R14 + MOVQ CX, BX + ROLQ CL, R14 + MOVL $0x00000001, R15 + MOVB R13, CL + SHLL CL, R15 + DECL R15 + ANDQ R15, R14 + ADDQ R14, R8 + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Offset State + MOVBQZX R9, R13 + SHRQ $0x10, R9 + MOVWQZX R9, R9 + LEAQ (BX)(R13*1), CX + MOVQ DX, R14 + MOVQ CX, BX + ROLQ CL, R14 + MOVL $0x00000001, R15 + MOVB R13, CL + SHLL CL, R15 + DECL R15 + ANDQ R15, R14 + ADDQ R14, R9 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R9*8), R9 + +sequenceDecs_decodeSync_amd64_skip_update: + // Adjust offset + MOVQ s+0(FP), CX + MOVQ 8(SP), R13 + CMPQ AX, $0x01 + JBE sequenceDecs_decodeSync_amd64_adjust_offsetB_1_or_0 + MOVUPS 144(CX), X0 + MOVQ R13, 144(CX) + MOVUPS X0, 152(CX) + JMP sequenceDecs_decodeSync_amd64_after_adjust + +sequenceDecs_decodeSync_amd64_adjust_offsetB_1_or_0: + CMPQ 24(SP), $0x00000000 + JNE sequenceDecs_decodeSync_amd64_adjust_offset_maybezero + INCQ R13 + JMP sequenceDecs_decodeSync_amd64_adjust_offset_nonzero + +sequenceDecs_decodeSync_amd64_adjust_offset_maybezero: + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_amd64_adjust_offset_nonzero + MOVQ 144(CX), R13 + JMP sequenceDecs_decodeSync_amd64_after_adjust + +sequenceDecs_decodeSync_amd64_adjust_offset_nonzero: + MOVQ R13, AX + XORQ R14, R14 + MOVQ $-1, R15 + CMPQ R13, $0x03 + CMOVQEQ R14, AX + CMOVQEQ R15, R14 + ADDQ 144(CX)(AX*8), R14 + JNZ sequenceDecs_decodeSync_amd64_adjust_temp_valid + MOVQ $0x00000001, R14 + +sequenceDecs_decodeSync_amd64_adjust_temp_valid: + CMPQ R13, $0x01 + JZ sequenceDecs_decodeSync_amd64_adjust_skip + MOVQ 152(CX), AX + MOVQ AX, 160(CX) + +sequenceDecs_decodeSync_amd64_adjust_skip: + MOVQ 144(CX), AX + MOVQ AX, 152(CX) + MOVQ R14, 144(CX) + MOVQ R14, R13 + +sequenceDecs_decodeSync_amd64_after_adjust: + MOVQ R13, 8(SP) + + // Check values + MOVQ 16(SP), AX + MOVQ 24(SP), CX + LEAQ (AX)(CX*1), R14 + MOVQ s+0(FP), R15 + ADDQ R14, 256(R15) + MOVQ ctx+16(FP), R14 + SUBQ CX, 104(R14) + JS error_not_enough_literals + CMPQ AX, $0x00020002 + JA sequenceDecs_decodeSync_amd64_error_match_len_too_big + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_amd64_match_len_ofs_ok + TESTQ AX, AX + JNZ sequenceDecs_decodeSync_amd64_error_match_len_ofs_mismatch + +sequenceDecs_decodeSync_amd64_match_len_ofs_ok: + MOVQ 24(SP), AX + MOVQ 8(SP), CX + MOVQ 16(SP), R13 + + // Check if we have enough space in s.out + LEAQ (AX)(R13*1), R14 + ADDQ R10, R14 + CMPQ R14, 32(SP) + JA error_not_enough_space + + // Copy literals + TESTQ AX, AX + JZ check_offset + XORQ R14, R14 + +copy_1: + MOVUPS (R11)(R14*1), X0 + MOVUPS X0, (R10)(R14*1) + ADDQ $0x10, R14 + CMPQ R14, AX + JB copy_1 + ADDQ AX, R11 + ADDQ AX, R10 + ADDQ AX, R12 + + // Malformed input if seq.mo > t+len(hist) || seq.mo > s.windowSize) +check_offset: + MOVQ R12, AX + ADDQ 40(SP), AX + CMPQ CX, AX + JG error_match_off_too_big + CMPQ CX, 56(SP) + JG error_match_off_too_big + + // Copy match from history + MOVQ CX, AX + SUBQ R12, AX + JLS copy_match + MOVQ 48(SP), R14 + SUBQ AX, R14 + CMPQ R13, AX + JG copy_all_from_history + MOVQ R13, AX + SUBQ $0x10, AX + JB copy_4_small + +copy_4_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R10) + ADDQ $0x10, R14 + ADDQ $0x10, R10 + SUBQ $0x10, AX + JAE copy_4_loop + LEAQ 16(R14)(AX*1), R14 + LEAQ 16(R10)(AX*1), R10 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R10) + JMP copy_4_end + +copy_4_small: + CMPQ R13, $0x03 + JE copy_4_move_3 + CMPQ R13, $0x08 + JB copy_4_move_4through7 + JMP copy_4_move_8through16 + +copy_4_move_3: + MOVW (R14), AX + MOVB 2(R14), CL + MOVW AX, (R10) + MOVB CL, 2(R10) + ADDQ R13, R14 + ADDQ R13, R10 + JMP copy_4_end + +copy_4_move_4through7: + MOVL (R14), AX + MOVL -4(R14)(R13*1), CX + MOVL AX, (R10) + MOVL CX, -4(R10)(R13*1) + ADDQ R13, R14 + ADDQ R13, R10 + JMP copy_4_end + +copy_4_move_8through16: + MOVQ (R14), AX + MOVQ -8(R14)(R13*1), CX + MOVQ AX, (R10) + MOVQ CX, -8(R10)(R13*1) + ADDQ R13, R14 + ADDQ R13, R10 + +copy_4_end: + ADDQ R13, R12 + JMP handle_loop + JMP loop_finished + +copy_all_from_history: + MOVQ AX, R15 + SUBQ $0x10, R15 + JB copy_5_small + +copy_5_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R10) + ADDQ $0x10, R14 + ADDQ $0x10, R10 + SUBQ $0x10, R15 + JAE copy_5_loop + LEAQ 16(R14)(R15*1), R14 + LEAQ 16(R10)(R15*1), R10 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R10) + JMP copy_5_end + +copy_5_small: + CMPQ AX, $0x03 + JE copy_5_move_3 + JB copy_5_move_1or2 + CMPQ AX, $0x08 + JB copy_5_move_4through7 + JMP copy_5_move_8through16 + +copy_5_move_1or2: + MOVB (R14), R15 + MOVB -1(R14)(AX*1), BP + MOVB R15, (R10) + MOVB BP, -1(R10)(AX*1) + ADDQ AX, R14 + ADDQ AX, R10 + JMP copy_5_end + +copy_5_move_3: + MOVW (R14), R15 + MOVB 2(R14), BP + MOVW R15, (R10) + MOVB BP, 2(R10) + ADDQ AX, R14 + ADDQ AX, R10 + JMP copy_5_end + +copy_5_move_4through7: + MOVL (R14), R15 + MOVL -4(R14)(AX*1), BP + MOVL R15, (R10) + MOVL BP, -4(R10)(AX*1) + ADDQ AX, R14 + ADDQ AX, R10 + JMP copy_5_end + +copy_5_move_8through16: + MOVQ (R14), R15 + MOVQ -8(R14)(AX*1), BP + MOVQ R15, (R10) + MOVQ BP, -8(R10)(AX*1) + ADDQ AX, R14 + ADDQ AX, R10 + +copy_5_end: + ADDQ AX, R12 + SUBQ AX, R13 + + // Copy match from the current buffer +copy_match: + MOVQ R10, AX + SUBQ CX, AX + + // ml <= mo + CMPQ R13, CX + JA copy_overlapping_match + + // Copy non-overlapping match + ADDQ R13, R12 + MOVQ R10, CX + ADDQ R13, R10 + +copy_2: + MOVUPS (AX), X0 + MOVUPS X0, (CX) + ADDQ $0x10, AX + ADDQ $0x10, CX + SUBQ $0x10, R13 + JHI copy_2 + JMP handle_loop + + // Copy overlapping match +copy_overlapping_match: + ADDQ R13, R12 + +copy_slow_3: + MOVB (AX), CL + MOVB CL, (R10) + INCQ AX + INCQ R10 + DECQ R13 + JNZ copy_slow_3 + +handle_loop: + MOVQ ctx+16(FP), AX + DECQ 96(AX) + JNS sequenceDecs_decodeSync_amd64_main_loop + +loop_finished: + MOVQ br+8(FP), AX + MOVQ DX, 32(AX) + MOVB BL, 40(AX) + MOVQ SI, 24(AX) + + // Update the context + MOVQ ctx+16(FP), AX + MOVQ R12, 136(AX) + MOVQ 144(AX), CX + SUBQ CX, R11 + MOVQ R11, 168(AX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decodeSync_amd64_error_match_len_ofs_mismatch: + MOVQ 16(SP), AX + MOVQ ctx+16(FP), CX + MOVQ AX, 216(CX) + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decodeSync_amd64_error_match_len_too_big: + MOVQ ctx+16(FP), AX + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error +error_match_off_too_big: + MOVQ ctx+16(FP), AX + MOVQ 8(SP), CX + MOVQ CX, 224(AX) + MOVQ R12, 136(AX) + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with overread error +error_overread: + MOVQ $0x00000006, ret+24(FP) + RET + + // Return with not enough output space error +error_not_enough_space: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ R12, 136(AX) + MOVQ $0x00000005, ret+24(FP) + RET + +// func sequenceDecs_decodeSync_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int +// Requires: BMI, BMI2, CMOV, SSE +TEXT ·sequenceDecs_decodeSync_bmi2(SB), $64-32 + MOVQ br+8(FP), CX + MOVQ 32(CX), AX + MOVBQZX 40(CX), DX + MOVQ 24(CX), BX + MOVQ (CX), CX + ADDQ BX, CX + MOVQ CX, (SP) + MOVQ ctx+16(FP), CX + MOVQ 72(CX), SI + MOVQ 80(CX), DI + MOVQ 88(CX), R8 + XORQ R9, R9 + MOVQ R9, 8(SP) + MOVQ R9, 16(SP) + MOVQ R9, 24(SP) + MOVQ 112(CX), R9 + MOVQ 128(CX), R10 + MOVQ R10, 32(SP) + MOVQ 144(CX), R10 + MOVQ 136(CX), R11 + MOVQ 200(CX), R12 + MOVQ R12, 56(SP) + MOVQ 176(CX), R12 + MOVQ R12, 48(SP) + MOVQ 184(CX), CX + MOVQ CX, 40(SP) + MOVQ 40(SP), CX + ADDQ CX, 48(SP) + + // Calculate poiter to s.out[cap(s.out)] (a past-end pointer) + ADDQ R9, 32(SP) + + // outBase += outPosition + ADDQ R11, R9 + +sequenceDecs_decodeSync_bmi2_main_loop: + MOVQ (SP), R12 + + // Fill bitreader to have enough for the offset and match length. + CMPQ BX, $0x08 + JL sequenceDecs_decodeSync_bmi2_fill_byte_by_byte + MOVQ DX, CX + SHRQ $0x03, CX + SUBQ CX, R12 + MOVQ (R12), AX + SUBQ CX, BX + ANDQ $0x07, DX + JMP sequenceDecs_decodeSync_bmi2_fill_end + +sequenceDecs_decodeSync_bmi2_fill_byte_by_byte: + CMPQ BX, $0x00 + JLE sequenceDecs_decodeSync_bmi2_fill_check_overread + CMPQ DX, $0x07 + JLE sequenceDecs_decodeSync_bmi2_fill_end + SHLQ $0x08, AX + SUBQ $0x01, R12 + SUBQ $0x01, BX + SUBQ $0x08, DX + MOVBQZX (R12), CX + ORQ CX, AX + JMP sequenceDecs_decodeSync_bmi2_fill_byte_by_byte + +sequenceDecs_decodeSync_bmi2_fill_check_overread: + CMPQ DX, $0x40 + JA error_overread + +sequenceDecs_decodeSync_bmi2_fill_end: + // Update offset + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R13 + MOVQ AX, R14 + LEAQ (DX)(R13*1), CX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + MOVQ CX, DX + MOVQ R8, CX + SHRQ $0x20, CX + ADDQ R14, CX + MOVQ CX, 8(SP) + + // Update match length + MOVQ $0x00000808, CX + BEXTRQ CX, DI, R13 + MOVQ AX, R14 + LEAQ (DX)(R13*1), CX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + MOVQ CX, DX + MOVQ DI, CX + SHRQ $0x20, CX + ADDQ R14, CX + MOVQ CX, 16(SP) + + // Fill bitreader to have enough for the remaining + CMPQ BX, $0x08 + JL sequenceDecs_decodeSync_bmi2_fill_2_byte_by_byte + MOVQ DX, CX + SHRQ $0x03, CX + SUBQ CX, R12 + MOVQ (R12), AX + SUBQ CX, BX + ANDQ $0x07, DX + JMP sequenceDecs_decodeSync_bmi2_fill_2_end + +sequenceDecs_decodeSync_bmi2_fill_2_byte_by_byte: + CMPQ BX, $0x00 + JLE sequenceDecs_decodeSync_bmi2_fill_2_check_overread + CMPQ DX, $0x07 + JLE sequenceDecs_decodeSync_bmi2_fill_2_end + SHLQ $0x08, AX + SUBQ $0x01, R12 + SUBQ $0x01, BX + SUBQ $0x08, DX + MOVBQZX (R12), CX + ORQ CX, AX + JMP sequenceDecs_decodeSync_bmi2_fill_2_byte_by_byte + +sequenceDecs_decodeSync_bmi2_fill_2_check_overread: + CMPQ DX, $0x40 + JA error_overread + +sequenceDecs_decodeSync_bmi2_fill_2_end: + // Update literal length + MOVQ $0x00000808, CX + BEXTRQ CX, SI, R13 + MOVQ AX, R14 + LEAQ (DX)(R13*1), CX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + MOVQ CX, DX + MOVQ SI, CX + SHRQ $0x20, CX + ADDQ R14, CX + MOVQ CX, 24(SP) + + // Fill bitreader for state updates + MOVQ R12, (SP) + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R12 + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decodeSync_bmi2_skip_update + LEAQ (SI)(DI*1), R13 + ADDQ R8, R13 + MOVBQZX R13, R13 + LEAQ (DX)(R13*1), CX + MOVQ AX, R14 + MOVQ CX, DX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + + // Update Offset State + BZHIQ R8, R14, CX + SHRXQ R8, R14, R14 + MOVQ $0x00001010, R13 + BEXTRQ R13, R8, R8 + ADDQ CX, R8 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Match Length State + BZHIQ DI, R14, CX + SHRXQ DI, R14, R14 + MOVQ $0x00001010, R13 + BEXTRQ R13, DI, DI + ADDQ CX, DI + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(DI*8), DI + + // Update Literal Length State + BZHIQ SI, R14, CX + MOVQ $0x00001010, R13 + BEXTRQ R13, SI, SI + ADDQ CX, SI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(SI*8), SI + +sequenceDecs_decodeSync_bmi2_skip_update: + // Adjust offset + MOVQ s+0(FP), CX + MOVQ 8(SP), R13 + CMPQ R12, $0x01 + JBE sequenceDecs_decodeSync_bmi2_adjust_offsetB_1_or_0 + MOVUPS 144(CX), X0 + MOVQ R13, 144(CX) + MOVUPS X0, 152(CX) + JMP sequenceDecs_decodeSync_bmi2_after_adjust + +sequenceDecs_decodeSync_bmi2_adjust_offsetB_1_or_0: + CMPQ 24(SP), $0x00000000 + JNE sequenceDecs_decodeSync_bmi2_adjust_offset_maybezero + INCQ R13 + JMP sequenceDecs_decodeSync_bmi2_adjust_offset_nonzero + +sequenceDecs_decodeSync_bmi2_adjust_offset_maybezero: + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_bmi2_adjust_offset_nonzero + MOVQ 144(CX), R13 + JMP sequenceDecs_decodeSync_bmi2_after_adjust + +sequenceDecs_decodeSync_bmi2_adjust_offset_nonzero: + MOVQ R13, R12 + XORQ R14, R14 + MOVQ $-1, R15 + CMPQ R13, $0x03 + CMOVQEQ R14, R12 + CMOVQEQ R15, R14 + ADDQ 144(CX)(R12*8), R14 + JNZ sequenceDecs_decodeSync_bmi2_adjust_temp_valid + MOVQ $0x00000001, R14 + +sequenceDecs_decodeSync_bmi2_adjust_temp_valid: + CMPQ R13, $0x01 + JZ sequenceDecs_decodeSync_bmi2_adjust_skip + MOVQ 152(CX), R12 + MOVQ R12, 160(CX) + +sequenceDecs_decodeSync_bmi2_adjust_skip: + MOVQ 144(CX), R12 + MOVQ R12, 152(CX) + MOVQ R14, 144(CX) + MOVQ R14, R13 + +sequenceDecs_decodeSync_bmi2_after_adjust: + MOVQ R13, 8(SP) + + // Check values + MOVQ 16(SP), CX + MOVQ 24(SP), R12 + LEAQ (CX)(R12*1), R14 + MOVQ s+0(FP), R15 + ADDQ R14, 256(R15) + MOVQ ctx+16(FP), R14 + SUBQ R12, 104(R14) + JS error_not_enough_literals + CMPQ CX, $0x00020002 + JA sequenceDecs_decodeSync_bmi2_error_match_len_too_big + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_bmi2_match_len_ofs_ok + TESTQ CX, CX + JNZ sequenceDecs_decodeSync_bmi2_error_match_len_ofs_mismatch + +sequenceDecs_decodeSync_bmi2_match_len_ofs_ok: + MOVQ 24(SP), CX + MOVQ 8(SP), R12 + MOVQ 16(SP), R13 + + // Check if we have enough space in s.out + LEAQ (CX)(R13*1), R14 + ADDQ R9, R14 + CMPQ R14, 32(SP) + JA error_not_enough_space + + // Copy literals + TESTQ CX, CX + JZ check_offset + XORQ R14, R14 + +copy_1: + MOVUPS (R10)(R14*1), X0 + MOVUPS X0, (R9)(R14*1) + ADDQ $0x10, R14 + CMPQ R14, CX + JB copy_1 + ADDQ CX, R10 + ADDQ CX, R9 + ADDQ CX, R11 + + // Malformed input if seq.mo > t+len(hist) || seq.mo > s.windowSize) +check_offset: + MOVQ R11, CX + ADDQ 40(SP), CX + CMPQ R12, CX + JG error_match_off_too_big + CMPQ R12, 56(SP) + JG error_match_off_too_big + + // Copy match from history + MOVQ R12, CX + SUBQ R11, CX + JLS copy_match + MOVQ 48(SP), R14 + SUBQ CX, R14 + CMPQ R13, CX + JG copy_all_from_history + MOVQ R13, CX + SUBQ $0x10, CX + JB copy_4_small + +copy_4_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R9) + ADDQ $0x10, R14 + ADDQ $0x10, R9 + SUBQ $0x10, CX + JAE copy_4_loop + LEAQ 16(R14)(CX*1), R14 + LEAQ 16(R9)(CX*1), R9 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R9) + JMP copy_4_end + +copy_4_small: + CMPQ R13, $0x03 + JE copy_4_move_3 + CMPQ R13, $0x08 + JB copy_4_move_4through7 + JMP copy_4_move_8through16 + +copy_4_move_3: + MOVW (R14), CX + MOVB 2(R14), R12 + MOVW CX, (R9) + MOVB R12, 2(R9) + ADDQ R13, R14 + ADDQ R13, R9 + JMP copy_4_end + +copy_4_move_4through7: + MOVL (R14), CX + MOVL -4(R14)(R13*1), R12 + MOVL CX, (R9) + MOVL R12, -4(R9)(R13*1) + ADDQ R13, R14 + ADDQ R13, R9 + JMP copy_4_end + +copy_4_move_8through16: + MOVQ (R14), CX + MOVQ -8(R14)(R13*1), R12 + MOVQ CX, (R9) + MOVQ R12, -8(R9)(R13*1) + ADDQ R13, R14 + ADDQ R13, R9 + +copy_4_end: + ADDQ R13, R11 + JMP handle_loop + JMP loop_finished + +copy_all_from_history: + MOVQ CX, R15 + SUBQ $0x10, R15 + JB copy_5_small + +copy_5_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R9) + ADDQ $0x10, R14 + ADDQ $0x10, R9 + SUBQ $0x10, R15 + JAE copy_5_loop + LEAQ 16(R14)(R15*1), R14 + LEAQ 16(R9)(R15*1), R9 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R9) + JMP copy_5_end + +copy_5_small: + CMPQ CX, $0x03 + JE copy_5_move_3 + JB copy_5_move_1or2 + CMPQ CX, $0x08 + JB copy_5_move_4through7 + JMP copy_5_move_8through16 + +copy_5_move_1or2: + MOVB (R14), R15 + MOVB -1(R14)(CX*1), BP + MOVB R15, (R9) + MOVB BP, -1(R9)(CX*1) + ADDQ CX, R14 + ADDQ CX, R9 + JMP copy_5_end + +copy_5_move_3: + MOVW (R14), R15 + MOVB 2(R14), BP + MOVW R15, (R9) + MOVB BP, 2(R9) + ADDQ CX, R14 + ADDQ CX, R9 + JMP copy_5_end + +copy_5_move_4through7: + MOVL (R14), R15 + MOVL -4(R14)(CX*1), BP + MOVL R15, (R9) + MOVL BP, -4(R9)(CX*1) + ADDQ CX, R14 + ADDQ CX, R9 + JMP copy_5_end + +copy_5_move_8through16: + MOVQ (R14), R15 + MOVQ -8(R14)(CX*1), BP + MOVQ R15, (R9) + MOVQ BP, -8(R9)(CX*1) + ADDQ CX, R14 + ADDQ CX, R9 + +copy_5_end: + ADDQ CX, R11 + SUBQ CX, R13 + + // Copy match from the current buffer +copy_match: + MOVQ R9, CX + SUBQ R12, CX + + // ml <= mo + CMPQ R13, R12 + JA copy_overlapping_match + + // Copy non-overlapping match + ADDQ R13, R11 + MOVQ R9, R12 + ADDQ R13, R9 + +copy_2: + MOVUPS (CX), X0 + MOVUPS X0, (R12) + ADDQ $0x10, CX + ADDQ $0x10, R12 + SUBQ $0x10, R13 + JHI copy_2 + JMP handle_loop + + // Copy overlapping match +copy_overlapping_match: + ADDQ R13, R11 + +copy_slow_3: + MOVB (CX), R12 + MOVB R12, (R9) + INCQ CX + INCQ R9 + DECQ R13 + JNZ copy_slow_3 + +handle_loop: + MOVQ ctx+16(FP), CX + DECQ 96(CX) + JNS sequenceDecs_decodeSync_bmi2_main_loop + +loop_finished: + MOVQ br+8(FP), CX + MOVQ AX, 32(CX) + MOVB DL, 40(CX) + MOVQ BX, 24(CX) + + // Update the context + MOVQ ctx+16(FP), AX + MOVQ R11, 136(AX) + MOVQ 144(AX), CX + SUBQ CX, R10 + MOVQ R10, 168(AX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decodeSync_bmi2_error_match_len_ofs_mismatch: + MOVQ 16(SP), AX + MOVQ ctx+16(FP), CX + MOVQ AX, 216(CX) + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decodeSync_bmi2_error_match_len_too_big: + MOVQ ctx+16(FP), AX + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error +error_match_off_too_big: + MOVQ ctx+16(FP), AX + MOVQ 8(SP), CX + MOVQ CX, 224(AX) + MOVQ R11, 136(AX) + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with overread error +error_overread: + MOVQ $0x00000006, ret+24(FP) + RET + + // Return with not enough output space error +error_not_enough_space: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ R11, 136(AX) + MOVQ $0x00000005, ret+24(FP) + RET + +// func sequenceDecs_decodeSync_safe_amd64(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int +// Requires: CMOV, SSE +TEXT ·sequenceDecs_decodeSync_safe_amd64(SB), $64-32 + MOVQ br+8(FP), AX + MOVQ 32(AX), DX + MOVBQZX 40(AX), BX + MOVQ 24(AX), SI + MOVQ (AX), AX + ADDQ SI, AX + MOVQ AX, (SP) + MOVQ ctx+16(FP), AX + MOVQ 72(AX), DI + MOVQ 80(AX), R8 + MOVQ 88(AX), R9 + XORQ CX, CX + MOVQ CX, 8(SP) + MOVQ CX, 16(SP) + MOVQ CX, 24(SP) + MOVQ 112(AX), R10 + MOVQ 128(AX), CX + MOVQ CX, 32(SP) + MOVQ 144(AX), R11 + MOVQ 136(AX), R12 + MOVQ 200(AX), CX + MOVQ CX, 56(SP) + MOVQ 176(AX), CX + MOVQ CX, 48(SP) + MOVQ 184(AX), AX + MOVQ AX, 40(SP) + MOVQ 40(SP), AX + ADDQ AX, 48(SP) + + // Calculate poiter to s.out[cap(s.out)] (a past-end pointer) + ADDQ R10, 32(SP) + + // outBase += outPosition + ADDQ R12, R10 + +sequenceDecs_decodeSync_safe_amd64_main_loop: + MOVQ (SP), R13 + + // Fill bitreader to have enough for the offset and match length. + CMPQ SI, $0x08 + JL sequenceDecs_decodeSync_safe_amd64_fill_byte_by_byte + MOVQ BX, AX + SHRQ $0x03, AX + SUBQ AX, R13 + MOVQ (R13), DX + SUBQ AX, SI + ANDQ $0x07, BX + JMP sequenceDecs_decodeSync_safe_amd64_fill_end + +sequenceDecs_decodeSync_safe_amd64_fill_byte_by_byte: + CMPQ SI, $0x00 + JLE sequenceDecs_decodeSync_safe_amd64_fill_check_overread + CMPQ BX, $0x07 + JLE sequenceDecs_decodeSync_safe_amd64_fill_end + SHLQ $0x08, DX + SUBQ $0x01, R13 + SUBQ $0x01, SI + SUBQ $0x08, BX + MOVBQZX (R13), AX + ORQ AX, DX + JMP sequenceDecs_decodeSync_safe_amd64_fill_byte_by_byte + +sequenceDecs_decodeSync_safe_amd64_fill_check_overread: + CMPQ BX, $0x40 + JA error_overread + +sequenceDecs_decodeSync_safe_amd64_fill_end: + // Update offset + MOVQ R9, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_safe_amd64_of_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_safe_amd64_of_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_safe_amd64_of_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_safe_amd64_of_update_zero: + MOVQ AX, 8(SP) + + // Update match length + MOVQ R8, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_safe_amd64_ml_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_safe_amd64_ml_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_safe_amd64_ml_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_safe_amd64_ml_update_zero: + MOVQ AX, 16(SP) + + // Fill bitreader to have enough for the remaining + CMPQ SI, $0x08 + JL sequenceDecs_decodeSync_safe_amd64_fill_2_byte_by_byte + MOVQ BX, AX + SHRQ $0x03, AX + SUBQ AX, R13 + MOVQ (R13), DX + SUBQ AX, SI + ANDQ $0x07, BX + JMP sequenceDecs_decodeSync_safe_amd64_fill_2_end + +sequenceDecs_decodeSync_safe_amd64_fill_2_byte_by_byte: + CMPQ SI, $0x00 + JLE sequenceDecs_decodeSync_safe_amd64_fill_2_check_overread + CMPQ BX, $0x07 + JLE sequenceDecs_decodeSync_safe_amd64_fill_2_end + SHLQ $0x08, DX + SUBQ $0x01, R13 + SUBQ $0x01, SI + SUBQ $0x08, BX + MOVBQZX (R13), AX + ORQ AX, DX + JMP sequenceDecs_decodeSync_safe_amd64_fill_2_byte_by_byte + +sequenceDecs_decodeSync_safe_amd64_fill_2_check_overread: + CMPQ BX, $0x40 + JA error_overread + +sequenceDecs_decodeSync_safe_amd64_fill_2_end: + // Update literal length + MOVQ DI, AX + MOVQ BX, CX + MOVQ DX, R14 + SHLQ CL, R14 + MOVB AH, CL + SHRQ $0x20, AX + TESTQ CX, CX + JZ sequenceDecs_decodeSync_safe_amd64_ll_update_zero + ADDQ CX, BX + CMPQ BX, $0x40 + JA sequenceDecs_decodeSync_safe_amd64_ll_update_zero + CMPQ CX, $0x40 + JAE sequenceDecs_decodeSync_safe_amd64_ll_update_zero + NEGQ CX + SHRQ CL, R14 + ADDQ R14, AX + +sequenceDecs_decodeSync_safe_amd64_ll_update_zero: + MOVQ AX, 24(SP) + + // Fill bitreader for state updates + MOVQ R13, (SP) + MOVQ R9, AX + SHRQ $0x08, AX + MOVBQZX AL, AX + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decodeSync_safe_amd64_skip_update + + // Update Literal Length State + MOVBQZX DI, R13 + SHRQ $0x10, DI + MOVWQZX DI, DI + LEAQ (BX)(R13*1), CX + MOVQ DX, R14 + MOVQ CX, BX + ROLQ CL, R14 + MOVL $0x00000001, R15 + MOVB R13, CL + SHLL CL, R15 + DECL R15 + ANDQ R15, R14 + ADDQ R14, DI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(DI*8), DI + + // Update Match Length State + MOVBQZX R8, R13 + SHRQ $0x10, R8 + MOVWQZX R8, R8 + LEAQ (BX)(R13*1), CX + MOVQ DX, R14 + MOVQ CX, BX + ROLQ CL, R14 + MOVL $0x00000001, R15 + MOVB R13, CL + SHLL CL, R15 + DECL R15 + ANDQ R15, R14 + ADDQ R14, R8 + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Offset State + MOVBQZX R9, R13 + SHRQ $0x10, R9 + MOVWQZX R9, R9 + LEAQ (BX)(R13*1), CX + MOVQ DX, R14 + MOVQ CX, BX + ROLQ CL, R14 + MOVL $0x00000001, R15 + MOVB R13, CL + SHLL CL, R15 + DECL R15 + ANDQ R15, R14 + ADDQ R14, R9 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R9*8), R9 + +sequenceDecs_decodeSync_safe_amd64_skip_update: + // Adjust offset + MOVQ s+0(FP), CX + MOVQ 8(SP), R13 + CMPQ AX, $0x01 + JBE sequenceDecs_decodeSync_safe_amd64_adjust_offsetB_1_or_0 + MOVUPS 144(CX), X0 + MOVQ R13, 144(CX) + MOVUPS X0, 152(CX) + JMP sequenceDecs_decodeSync_safe_amd64_after_adjust + +sequenceDecs_decodeSync_safe_amd64_adjust_offsetB_1_or_0: + CMPQ 24(SP), $0x00000000 + JNE sequenceDecs_decodeSync_safe_amd64_adjust_offset_maybezero + INCQ R13 + JMP sequenceDecs_decodeSync_safe_amd64_adjust_offset_nonzero + +sequenceDecs_decodeSync_safe_amd64_adjust_offset_maybezero: + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_safe_amd64_adjust_offset_nonzero + MOVQ 144(CX), R13 + JMP sequenceDecs_decodeSync_safe_amd64_after_adjust + +sequenceDecs_decodeSync_safe_amd64_adjust_offset_nonzero: + MOVQ R13, AX + XORQ R14, R14 + MOVQ $-1, R15 + CMPQ R13, $0x03 + CMOVQEQ R14, AX + CMOVQEQ R15, R14 + ADDQ 144(CX)(AX*8), R14 + JNZ sequenceDecs_decodeSync_safe_amd64_adjust_temp_valid + MOVQ $0x00000001, R14 + +sequenceDecs_decodeSync_safe_amd64_adjust_temp_valid: + CMPQ R13, $0x01 + JZ sequenceDecs_decodeSync_safe_amd64_adjust_skip + MOVQ 152(CX), AX + MOVQ AX, 160(CX) + +sequenceDecs_decodeSync_safe_amd64_adjust_skip: + MOVQ 144(CX), AX + MOVQ AX, 152(CX) + MOVQ R14, 144(CX) + MOVQ R14, R13 + +sequenceDecs_decodeSync_safe_amd64_after_adjust: + MOVQ R13, 8(SP) + + // Check values + MOVQ 16(SP), AX + MOVQ 24(SP), CX + LEAQ (AX)(CX*1), R14 + MOVQ s+0(FP), R15 + ADDQ R14, 256(R15) + MOVQ ctx+16(FP), R14 + SUBQ CX, 104(R14) + JS error_not_enough_literals + CMPQ AX, $0x00020002 + JA sequenceDecs_decodeSync_safe_amd64_error_match_len_too_big + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_safe_amd64_match_len_ofs_ok + TESTQ AX, AX + JNZ sequenceDecs_decodeSync_safe_amd64_error_match_len_ofs_mismatch + +sequenceDecs_decodeSync_safe_amd64_match_len_ofs_ok: + MOVQ 24(SP), AX + MOVQ 8(SP), CX + MOVQ 16(SP), R13 + + // Check if we have enough space in s.out + LEAQ (AX)(R13*1), R14 + ADDQ R10, R14 + CMPQ R14, 32(SP) + JA error_not_enough_space + + // Copy literals + TESTQ AX, AX + JZ check_offset + MOVQ AX, R14 + SUBQ $0x10, R14 + JB copy_1_small + +copy_1_loop: + MOVUPS (R11), X0 + MOVUPS X0, (R10) + ADDQ $0x10, R11 + ADDQ $0x10, R10 + SUBQ $0x10, R14 + JAE copy_1_loop + LEAQ 16(R11)(R14*1), R11 + LEAQ 16(R10)(R14*1), R10 + MOVUPS -16(R11), X0 + MOVUPS X0, -16(R10) + JMP copy_1_end + +copy_1_small: + CMPQ AX, $0x03 + JE copy_1_move_3 + JB copy_1_move_1or2 + CMPQ AX, $0x08 + JB copy_1_move_4through7 + JMP copy_1_move_8through16 + +copy_1_move_1or2: + MOVB (R11), R14 + MOVB -1(R11)(AX*1), R15 + MOVB R14, (R10) + MOVB R15, -1(R10)(AX*1) + ADDQ AX, R11 + ADDQ AX, R10 + JMP copy_1_end + +copy_1_move_3: + MOVW (R11), R14 + MOVB 2(R11), R15 + MOVW R14, (R10) + MOVB R15, 2(R10) + ADDQ AX, R11 + ADDQ AX, R10 + JMP copy_1_end + +copy_1_move_4through7: + MOVL (R11), R14 + MOVL -4(R11)(AX*1), R15 + MOVL R14, (R10) + MOVL R15, -4(R10)(AX*1) + ADDQ AX, R11 + ADDQ AX, R10 + JMP copy_1_end + +copy_1_move_8through16: + MOVQ (R11), R14 + MOVQ -8(R11)(AX*1), R15 + MOVQ R14, (R10) + MOVQ R15, -8(R10)(AX*1) + ADDQ AX, R11 + ADDQ AX, R10 + +copy_1_end: + ADDQ AX, R12 + + // Malformed input if seq.mo > t+len(hist) || seq.mo > s.windowSize) +check_offset: + MOVQ R12, AX + ADDQ 40(SP), AX + CMPQ CX, AX + JG error_match_off_too_big + CMPQ CX, 56(SP) + JG error_match_off_too_big + + // Copy match from history + MOVQ CX, AX + SUBQ R12, AX + JLS copy_match + MOVQ 48(SP), R14 + SUBQ AX, R14 + CMPQ R13, AX + JG copy_all_from_history + MOVQ R13, AX + SUBQ $0x10, AX + JB copy_4_small + +copy_4_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R10) + ADDQ $0x10, R14 + ADDQ $0x10, R10 + SUBQ $0x10, AX + JAE copy_4_loop + LEAQ 16(R14)(AX*1), R14 + LEAQ 16(R10)(AX*1), R10 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R10) + JMP copy_4_end + +copy_4_small: + CMPQ R13, $0x03 + JE copy_4_move_3 + CMPQ R13, $0x08 + JB copy_4_move_4through7 + JMP copy_4_move_8through16 + +copy_4_move_3: + MOVW (R14), AX + MOVB 2(R14), CL + MOVW AX, (R10) + MOVB CL, 2(R10) + ADDQ R13, R14 + ADDQ R13, R10 + JMP copy_4_end + +copy_4_move_4through7: + MOVL (R14), AX + MOVL -4(R14)(R13*1), CX + MOVL AX, (R10) + MOVL CX, -4(R10)(R13*1) + ADDQ R13, R14 + ADDQ R13, R10 + JMP copy_4_end + +copy_4_move_8through16: + MOVQ (R14), AX + MOVQ -8(R14)(R13*1), CX + MOVQ AX, (R10) + MOVQ CX, -8(R10)(R13*1) + ADDQ R13, R14 + ADDQ R13, R10 + +copy_4_end: + ADDQ R13, R12 + JMP handle_loop + JMP loop_finished + +copy_all_from_history: + MOVQ AX, R15 + SUBQ $0x10, R15 + JB copy_5_small + +copy_5_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R10) + ADDQ $0x10, R14 + ADDQ $0x10, R10 + SUBQ $0x10, R15 + JAE copy_5_loop + LEAQ 16(R14)(R15*1), R14 + LEAQ 16(R10)(R15*1), R10 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R10) + JMP copy_5_end + +copy_5_small: + CMPQ AX, $0x03 + JE copy_5_move_3 + JB copy_5_move_1or2 + CMPQ AX, $0x08 + JB copy_5_move_4through7 + JMP copy_5_move_8through16 + +copy_5_move_1or2: + MOVB (R14), R15 + MOVB -1(R14)(AX*1), BP + MOVB R15, (R10) + MOVB BP, -1(R10)(AX*1) + ADDQ AX, R14 + ADDQ AX, R10 + JMP copy_5_end + +copy_5_move_3: + MOVW (R14), R15 + MOVB 2(R14), BP + MOVW R15, (R10) + MOVB BP, 2(R10) + ADDQ AX, R14 + ADDQ AX, R10 + JMP copy_5_end + +copy_5_move_4through7: + MOVL (R14), R15 + MOVL -4(R14)(AX*1), BP + MOVL R15, (R10) + MOVL BP, -4(R10)(AX*1) + ADDQ AX, R14 + ADDQ AX, R10 + JMP copy_5_end + +copy_5_move_8through16: + MOVQ (R14), R15 + MOVQ -8(R14)(AX*1), BP + MOVQ R15, (R10) + MOVQ BP, -8(R10)(AX*1) + ADDQ AX, R14 + ADDQ AX, R10 + +copy_5_end: + ADDQ AX, R12 + SUBQ AX, R13 + + // Copy match from the current buffer +copy_match: + MOVQ R10, AX + SUBQ CX, AX + + // ml <= mo + CMPQ R13, CX + JA copy_overlapping_match + + // Copy non-overlapping match + ADDQ R13, R12 + MOVQ R13, CX + SUBQ $0x10, CX + JB copy_2_small + +copy_2_loop: + MOVUPS (AX), X0 + MOVUPS X0, (R10) + ADDQ $0x10, AX + ADDQ $0x10, R10 + SUBQ $0x10, CX + JAE copy_2_loop + LEAQ 16(AX)(CX*1), AX + LEAQ 16(R10)(CX*1), R10 + MOVUPS -16(AX), X0 + MOVUPS X0, -16(R10) + JMP copy_2_end + +copy_2_small: + CMPQ R13, $0x03 + JE copy_2_move_3 + JB copy_2_move_1or2 + CMPQ R13, $0x08 + JB copy_2_move_4through7 + JMP copy_2_move_8through16 + +copy_2_move_1or2: + MOVB (AX), CL + MOVB -1(AX)(R13*1), R14 + MOVB CL, (R10) + MOVB R14, -1(R10)(R13*1) + ADDQ R13, AX + ADDQ R13, R10 + JMP copy_2_end + +copy_2_move_3: + MOVW (AX), CX + MOVB 2(AX), R14 + MOVW CX, (R10) + MOVB R14, 2(R10) + ADDQ R13, AX + ADDQ R13, R10 + JMP copy_2_end + +copy_2_move_4through7: + MOVL (AX), CX + MOVL -4(AX)(R13*1), R14 + MOVL CX, (R10) + MOVL R14, -4(R10)(R13*1) + ADDQ R13, AX + ADDQ R13, R10 + JMP copy_2_end + +copy_2_move_8through16: + MOVQ (AX), CX + MOVQ -8(AX)(R13*1), R14 + MOVQ CX, (R10) + MOVQ R14, -8(R10)(R13*1) + ADDQ R13, AX + ADDQ R13, R10 + +copy_2_end: + JMP handle_loop + + // Copy overlapping match +copy_overlapping_match: + ADDQ R13, R12 + +copy_slow_3: + MOVB (AX), CL + MOVB CL, (R10) + INCQ AX + INCQ R10 + DECQ R13 + JNZ copy_slow_3 + +handle_loop: + MOVQ ctx+16(FP), AX + DECQ 96(AX) + JNS sequenceDecs_decodeSync_safe_amd64_main_loop + +loop_finished: + MOVQ br+8(FP), AX + MOVQ DX, 32(AX) + MOVB BL, 40(AX) + MOVQ SI, 24(AX) + + // Update the context + MOVQ ctx+16(FP), AX + MOVQ R12, 136(AX) + MOVQ 144(AX), CX + SUBQ CX, R11 + MOVQ R11, 168(AX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decodeSync_safe_amd64_error_match_len_ofs_mismatch: + MOVQ 16(SP), AX + MOVQ ctx+16(FP), CX + MOVQ AX, 216(CX) + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decodeSync_safe_amd64_error_match_len_too_big: + MOVQ ctx+16(FP), AX + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error +error_match_off_too_big: + MOVQ ctx+16(FP), AX + MOVQ 8(SP), CX + MOVQ CX, 224(AX) + MOVQ R12, 136(AX) + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with overread error +error_overread: + MOVQ $0x00000006, ret+24(FP) + RET + + // Return with not enough output space error +error_not_enough_space: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ R12, 136(AX) + MOVQ $0x00000005, ret+24(FP) + RET + +// func sequenceDecs_decodeSync_safe_bmi2(s *sequenceDecs, br *bitReader, ctx *decodeSyncAsmContext) int +// Requires: BMI, BMI2, CMOV, SSE +TEXT ·sequenceDecs_decodeSync_safe_bmi2(SB), $64-32 + MOVQ br+8(FP), CX + MOVQ 32(CX), AX + MOVBQZX 40(CX), DX + MOVQ 24(CX), BX + MOVQ (CX), CX + ADDQ BX, CX + MOVQ CX, (SP) + MOVQ ctx+16(FP), CX + MOVQ 72(CX), SI + MOVQ 80(CX), DI + MOVQ 88(CX), R8 + XORQ R9, R9 + MOVQ R9, 8(SP) + MOVQ R9, 16(SP) + MOVQ R9, 24(SP) + MOVQ 112(CX), R9 + MOVQ 128(CX), R10 + MOVQ R10, 32(SP) + MOVQ 144(CX), R10 + MOVQ 136(CX), R11 + MOVQ 200(CX), R12 + MOVQ R12, 56(SP) + MOVQ 176(CX), R12 + MOVQ R12, 48(SP) + MOVQ 184(CX), CX + MOVQ CX, 40(SP) + MOVQ 40(SP), CX + ADDQ CX, 48(SP) + + // Calculate poiter to s.out[cap(s.out)] (a past-end pointer) + ADDQ R9, 32(SP) + + // outBase += outPosition + ADDQ R11, R9 + +sequenceDecs_decodeSync_safe_bmi2_main_loop: + MOVQ (SP), R12 + + // Fill bitreader to have enough for the offset and match length. + CMPQ BX, $0x08 + JL sequenceDecs_decodeSync_safe_bmi2_fill_byte_by_byte + MOVQ DX, CX + SHRQ $0x03, CX + SUBQ CX, R12 + MOVQ (R12), AX + SUBQ CX, BX + ANDQ $0x07, DX + JMP sequenceDecs_decodeSync_safe_bmi2_fill_end + +sequenceDecs_decodeSync_safe_bmi2_fill_byte_by_byte: + CMPQ BX, $0x00 + JLE sequenceDecs_decodeSync_safe_bmi2_fill_check_overread + CMPQ DX, $0x07 + JLE sequenceDecs_decodeSync_safe_bmi2_fill_end + SHLQ $0x08, AX + SUBQ $0x01, R12 + SUBQ $0x01, BX + SUBQ $0x08, DX + MOVBQZX (R12), CX + ORQ CX, AX + JMP sequenceDecs_decodeSync_safe_bmi2_fill_byte_by_byte + +sequenceDecs_decodeSync_safe_bmi2_fill_check_overread: + CMPQ DX, $0x40 + JA error_overread + +sequenceDecs_decodeSync_safe_bmi2_fill_end: + // Update offset + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R13 + MOVQ AX, R14 + LEAQ (DX)(R13*1), CX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + MOVQ CX, DX + MOVQ R8, CX + SHRQ $0x20, CX + ADDQ R14, CX + MOVQ CX, 8(SP) + + // Update match length + MOVQ $0x00000808, CX + BEXTRQ CX, DI, R13 + MOVQ AX, R14 + LEAQ (DX)(R13*1), CX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + MOVQ CX, DX + MOVQ DI, CX + SHRQ $0x20, CX + ADDQ R14, CX + MOVQ CX, 16(SP) + + // Fill bitreader to have enough for the remaining + CMPQ BX, $0x08 + JL sequenceDecs_decodeSync_safe_bmi2_fill_2_byte_by_byte + MOVQ DX, CX + SHRQ $0x03, CX + SUBQ CX, R12 + MOVQ (R12), AX + SUBQ CX, BX + ANDQ $0x07, DX + JMP sequenceDecs_decodeSync_safe_bmi2_fill_2_end + +sequenceDecs_decodeSync_safe_bmi2_fill_2_byte_by_byte: + CMPQ BX, $0x00 + JLE sequenceDecs_decodeSync_safe_bmi2_fill_2_check_overread + CMPQ DX, $0x07 + JLE sequenceDecs_decodeSync_safe_bmi2_fill_2_end + SHLQ $0x08, AX + SUBQ $0x01, R12 + SUBQ $0x01, BX + SUBQ $0x08, DX + MOVBQZX (R12), CX + ORQ CX, AX + JMP sequenceDecs_decodeSync_safe_bmi2_fill_2_byte_by_byte + +sequenceDecs_decodeSync_safe_bmi2_fill_2_check_overread: + CMPQ DX, $0x40 + JA error_overread + +sequenceDecs_decodeSync_safe_bmi2_fill_2_end: + // Update literal length + MOVQ $0x00000808, CX + BEXTRQ CX, SI, R13 + MOVQ AX, R14 + LEAQ (DX)(R13*1), CX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + MOVQ CX, DX + MOVQ SI, CX + SHRQ $0x20, CX + ADDQ R14, CX + MOVQ CX, 24(SP) + + // Fill bitreader for state updates + MOVQ R12, (SP) + MOVQ $0x00000808, CX + BEXTRQ CX, R8, R12 + MOVQ ctx+16(FP), CX + CMPQ 96(CX), $0x00 + JZ sequenceDecs_decodeSync_safe_bmi2_skip_update + LEAQ (SI)(DI*1), R13 + ADDQ R8, R13 + MOVBQZX R13, R13 + LEAQ (DX)(R13*1), CX + MOVQ AX, R14 + MOVQ CX, DX + ROLQ CL, R14 + BZHIQ R13, R14, R14 + + // Update Offset State + BZHIQ R8, R14, CX + SHRXQ R8, R14, R14 + MOVQ $0x00001010, R13 + BEXTRQ R13, R8, R8 + ADDQ CX, R8 + + // Load ctx.ofTable + MOVQ ctx+16(FP), CX + MOVQ 48(CX), CX + MOVQ (CX)(R8*8), R8 + + // Update Match Length State + BZHIQ DI, R14, CX + SHRXQ DI, R14, R14 + MOVQ $0x00001010, R13 + BEXTRQ R13, DI, DI + ADDQ CX, DI + + // Load ctx.mlTable + MOVQ ctx+16(FP), CX + MOVQ 24(CX), CX + MOVQ (CX)(DI*8), DI + + // Update Literal Length State + BZHIQ SI, R14, CX + MOVQ $0x00001010, R13 + BEXTRQ R13, SI, SI + ADDQ CX, SI + + // Load ctx.llTable + MOVQ ctx+16(FP), CX + MOVQ (CX), CX + MOVQ (CX)(SI*8), SI + +sequenceDecs_decodeSync_safe_bmi2_skip_update: + // Adjust offset + MOVQ s+0(FP), CX + MOVQ 8(SP), R13 + CMPQ R12, $0x01 + JBE sequenceDecs_decodeSync_safe_bmi2_adjust_offsetB_1_or_0 + MOVUPS 144(CX), X0 + MOVQ R13, 144(CX) + MOVUPS X0, 152(CX) + JMP sequenceDecs_decodeSync_safe_bmi2_after_adjust + +sequenceDecs_decodeSync_safe_bmi2_adjust_offsetB_1_or_0: + CMPQ 24(SP), $0x00000000 + JNE sequenceDecs_decodeSync_safe_bmi2_adjust_offset_maybezero + INCQ R13 + JMP sequenceDecs_decodeSync_safe_bmi2_adjust_offset_nonzero + +sequenceDecs_decodeSync_safe_bmi2_adjust_offset_maybezero: + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_safe_bmi2_adjust_offset_nonzero + MOVQ 144(CX), R13 + JMP sequenceDecs_decodeSync_safe_bmi2_after_adjust + +sequenceDecs_decodeSync_safe_bmi2_adjust_offset_nonzero: + MOVQ R13, R12 + XORQ R14, R14 + MOVQ $-1, R15 + CMPQ R13, $0x03 + CMOVQEQ R14, R12 + CMOVQEQ R15, R14 + ADDQ 144(CX)(R12*8), R14 + JNZ sequenceDecs_decodeSync_safe_bmi2_adjust_temp_valid + MOVQ $0x00000001, R14 + +sequenceDecs_decodeSync_safe_bmi2_adjust_temp_valid: + CMPQ R13, $0x01 + JZ sequenceDecs_decodeSync_safe_bmi2_adjust_skip + MOVQ 152(CX), R12 + MOVQ R12, 160(CX) + +sequenceDecs_decodeSync_safe_bmi2_adjust_skip: + MOVQ 144(CX), R12 + MOVQ R12, 152(CX) + MOVQ R14, 144(CX) + MOVQ R14, R13 + +sequenceDecs_decodeSync_safe_bmi2_after_adjust: + MOVQ R13, 8(SP) + + // Check values + MOVQ 16(SP), CX + MOVQ 24(SP), R12 + LEAQ (CX)(R12*1), R14 + MOVQ s+0(FP), R15 + ADDQ R14, 256(R15) + MOVQ ctx+16(FP), R14 + SUBQ R12, 104(R14) + JS error_not_enough_literals + CMPQ CX, $0x00020002 + JA sequenceDecs_decodeSync_safe_bmi2_error_match_len_too_big + TESTQ R13, R13 + JNZ sequenceDecs_decodeSync_safe_bmi2_match_len_ofs_ok + TESTQ CX, CX + JNZ sequenceDecs_decodeSync_safe_bmi2_error_match_len_ofs_mismatch + +sequenceDecs_decodeSync_safe_bmi2_match_len_ofs_ok: + MOVQ 24(SP), CX + MOVQ 8(SP), R12 + MOVQ 16(SP), R13 + + // Check if we have enough space in s.out + LEAQ (CX)(R13*1), R14 + ADDQ R9, R14 + CMPQ R14, 32(SP) + JA error_not_enough_space + + // Copy literals + TESTQ CX, CX + JZ check_offset + MOVQ CX, R14 + SUBQ $0x10, R14 + JB copy_1_small + +copy_1_loop: + MOVUPS (R10), X0 + MOVUPS X0, (R9) + ADDQ $0x10, R10 + ADDQ $0x10, R9 + SUBQ $0x10, R14 + JAE copy_1_loop + LEAQ 16(R10)(R14*1), R10 + LEAQ 16(R9)(R14*1), R9 + MOVUPS -16(R10), X0 + MOVUPS X0, -16(R9) + JMP copy_1_end + +copy_1_small: + CMPQ CX, $0x03 + JE copy_1_move_3 + JB copy_1_move_1or2 + CMPQ CX, $0x08 + JB copy_1_move_4through7 + JMP copy_1_move_8through16 + +copy_1_move_1or2: + MOVB (R10), R14 + MOVB -1(R10)(CX*1), R15 + MOVB R14, (R9) + MOVB R15, -1(R9)(CX*1) + ADDQ CX, R10 + ADDQ CX, R9 + JMP copy_1_end + +copy_1_move_3: + MOVW (R10), R14 + MOVB 2(R10), R15 + MOVW R14, (R9) + MOVB R15, 2(R9) + ADDQ CX, R10 + ADDQ CX, R9 + JMP copy_1_end + +copy_1_move_4through7: + MOVL (R10), R14 + MOVL -4(R10)(CX*1), R15 + MOVL R14, (R9) + MOVL R15, -4(R9)(CX*1) + ADDQ CX, R10 + ADDQ CX, R9 + JMP copy_1_end + +copy_1_move_8through16: + MOVQ (R10), R14 + MOVQ -8(R10)(CX*1), R15 + MOVQ R14, (R9) + MOVQ R15, -8(R9)(CX*1) + ADDQ CX, R10 + ADDQ CX, R9 + +copy_1_end: + ADDQ CX, R11 + + // Malformed input if seq.mo > t+len(hist) || seq.mo > s.windowSize) +check_offset: + MOVQ R11, CX + ADDQ 40(SP), CX + CMPQ R12, CX + JG error_match_off_too_big + CMPQ R12, 56(SP) + JG error_match_off_too_big + + // Copy match from history + MOVQ R12, CX + SUBQ R11, CX + JLS copy_match + MOVQ 48(SP), R14 + SUBQ CX, R14 + CMPQ R13, CX + JG copy_all_from_history + MOVQ R13, CX + SUBQ $0x10, CX + JB copy_4_small + +copy_4_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R9) + ADDQ $0x10, R14 + ADDQ $0x10, R9 + SUBQ $0x10, CX + JAE copy_4_loop + LEAQ 16(R14)(CX*1), R14 + LEAQ 16(R9)(CX*1), R9 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R9) + JMP copy_4_end + +copy_4_small: + CMPQ R13, $0x03 + JE copy_4_move_3 + CMPQ R13, $0x08 + JB copy_4_move_4through7 + JMP copy_4_move_8through16 + +copy_4_move_3: + MOVW (R14), CX + MOVB 2(R14), R12 + MOVW CX, (R9) + MOVB R12, 2(R9) + ADDQ R13, R14 + ADDQ R13, R9 + JMP copy_4_end + +copy_4_move_4through7: + MOVL (R14), CX + MOVL -4(R14)(R13*1), R12 + MOVL CX, (R9) + MOVL R12, -4(R9)(R13*1) + ADDQ R13, R14 + ADDQ R13, R9 + JMP copy_4_end + +copy_4_move_8through16: + MOVQ (R14), CX + MOVQ -8(R14)(R13*1), R12 + MOVQ CX, (R9) + MOVQ R12, -8(R9)(R13*1) + ADDQ R13, R14 + ADDQ R13, R9 + +copy_4_end: + ADDQ R13, R11 + JMP handle_loop + JMP loop_finished + +copy_all_from_history: + MOVQ CX, R15 + SUBQ $0x10, R15 + JB copy_5_small + +copy_5_loop: + MOVUPS (R14), X0 + MOVUPS X0, (R9) + ADDQ $0x10, R14 + ADDQ $0x10, R9 + SUBQ $0x10, R15 + JAE copy_5_loop + LEAQ 16(R14)(R15*1), R14 + LEAQ 16(R9)(R15*1), R9 + MOVUPS -16(R14), X0 + MOVUPS X0, -16(R9) + JMP copy_5_end + +copy_5_small: + CMPQ CX, $0x03 + JE copy_5_move_3 + JB copy_5_move_1or2 + CMPQ CX, $0x08 + JB copy_5_move_4through7 + JMP copy_5_move_8through16 + +copy_5_move_1or2: + MOVB (R14), R15 + MOVB -1(R14)(CX*1), BP + MOVB R15, (R9) + MOVB BP, -1(R9)(CX*1) + ADDQ CX, R14 + ADDQ CX, R9 + JMP copy_5_end + +copy_5_move_3: + MOVW (R14), R15 + MOVB 2(R14), BP + MOVW R15, (R9) + MOVB BP, 2(R9) + ADDQ CX, R14 + ADDQ CX, R9 + JMP copy_5_end + +copy_5_move_4through7: + MOVL (R14), R15 + MOVL -4(R14)(CX*1), BP + MOVL R15, (R9) + MOVL BP, -4(R9)(CX*1) + ADDQ CX, R14 + ADDQ CX, R9 + JMP copy_5_end + +copy_5_move_8through16: + MOVQ (R14), R15 + MOVQ -8(R14)(CX*1), BP + MOVQ R15, (R9) + MOVQ BP, -8(R9)(CX*1) + ADDQ CX, R14 + ADDQ CX, R9 + +copy_5_end: + ADDQ CX, R11 + SUBQ CX, R13 + + // Copy match from the current buffer +copy_match: + MOVQ R9, CX + SUBQ R12, CX + + // ml <= mo + CMPQ R13, R12 + JA copy_overlapping_match + + // Copy non-overlapping match + ADDQ R13, R11 + MOVQ R13, R12 + SUBQ $0x10, R12 + JB copy_2_small + +copy_2_loop: + MOVUPS (CX), X0 + MOVUPS X0, (R9) + ADDQ $0x10, CX + ADDQ $0x10, R9 + SUBQ $0x10, R12 + JAE copy_2_loop + LEAQ 16(CX)(R12*1), CX + LEAQ 16(R9)(R12*1), R9 + MOVUPS -16(CX), X0 + MOVUPS X0, -16(R9) + JMP copy_2_end + +copy_2_small: + CMPQ R13, $0x03 + JE copy_2_move_3 + JB copy_2_move_1or2 + CMPQ R13, $0x08 + JB copy_2_move_4through7 + JMP copy_2_move_8through16 + +copy_2_move_1or2: + MOVB (CX), R12 + MOVB -1(CX)(R13*1), R14 + MOVB R12, (R9) + MOVB R14, -1(R9)(R13*1) + ADDQ R13, CX + ADDQ R13, R9 + JMP copy_2_end + +copy_2_move_3: + MOVW (CX), R12 + MOVB 2(CX), R14 + MOVW R12, (R9) + MOVB R14, 2(R9) + ADDQ R13, CX + ADDQ R13, R9 + JMP copy_2_end + +copy_2_move_4through7: + MOVL (CX), R12 + MOVL -4(CX)(R13*1), R14 + MOVL R12, (R9) + MOVL R14, -4(R9)(R13*1) + ADDQ R13, CX + ADDQ R13, R9 + JMP copy_2_end + +copy_2_move_8through16: + MOVQ (CX), R12 + MOVQ -8(CX)(R13*1), R14 + MOVQ R12, (R9) + MOVQ R14, -8(R9)(R13*1) + ADDQ R13, CX + ADDQ R13, R9 + +copy_2_end: + JMP handle_loop + + // Copy overlapping match +copy_overlapping_match: + ADDQ R13, R11 + +copy_slow_3: + MOVB (CX), R12 + MOVB R12, (R9) + INCQ CX + INCQ R9 + DECQ R13 + JNZ copy_slow_3 + +handle_loop: + MOVQ ctx+16(FP), CX + DECQ 96(CX) + JNS sequenceDecs_decodeSync_safe_bmi2_main_loop + +loop_finished: + MOVQ br+8(FP), CX + MOVQ AX, 32(CX) + MOVB DL, 40(CX) + MOVQ BX, 24(CX) + + // Update the context + MOVQ ctx+16(FP), AX + MOVQ R11, 136(AX) + MOVQ 144(AX), CX + SUBQ CX, R10 + MOVQ R10, 168(AX) + + // Return success + MOVQ $0x00000000, ret+24(FP) + RET + + // Return with match length error +sequenceDecs_decodeSync_safe_bmi2_error_match_len_ofs_mismatch: + MOVQ 16(SP), AX + MOVQ ctx+16(FP), CX + MOVQ AX, 216(CX) + MOVQ $0x00000001, ret+24(FP) + RET + + // Return with match too long error +sequenceDecs_decodeSync_safe_bmi2_error_match_len_too_big: + MOVQ ctx+16(FP), AX + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ $0x00000002, ret+24(FP) + RET + + // Return with match offset too long error +error_match_off_too_big: + MOVQ ctx+16(FP), AX + MOVQ 8(SP), CX + MOVQ CX, 224(AX) + MOVQ R11, 136(AX) + MOVQ $0x00000003, ret+24(FP) + RET + + // Return with not enough literals error +error_not_enough_literals: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ $0x00000004, ret+24(FP) + RET + + // Return with overread error +error_overread: + MOVQ $0x00000006, ret+24(FP) + RET + + // Return with not enough output space error +error_not_enough_space: + MOVQ ctx+16(FP), AX + MOVQ 24(SP), CX + MOVQ CX, 208(AX) + MOVQ 16(SP), CX + MOVQ CX, 216(AX) + MOVQ R11, 136(AX) + MOVQ $0x00000005, ret+24(FP) + RET diff --git a/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go b/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go new file mode 100644 index 000000000..ac2a80d29 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/seqdec_generic.go @@ -0,0 +1,237 @@ +//go:build !amd64 || appengine || !gc || noasm +// +build !amd64 appengine !gc noasm + +package zstd + +import ( + "fmt" + "io" +) + +// decode sequences from the stream with the provided history but without dictionary. +func (s *sequenceDecs) decodeSyncSimple(hist []byte) (bool, error) { + return false, nil +} + +// decode sequences from the stream without the provided history. +func (s *sequenceDecs) decode(seqs []seqVals) error { + br := s.br + + // Grab full sizes tables, to avoid bounds checks. + llTable, mlTable, ofTable := s.litLengths.fse.dt[:maxTablesize], s.matchLengths.fse.dt[:maxTablesize], s.offsets.fse.dt[:maxTablesize] + llState, mlState, ofState := s.litLengths.state.state, s.matchLengths.state.state, s.offsets.state.state + s.seqSize = 0 + litRemain := len(s.literals) + + maxBlockSize := maxCompressedBlockSize + if s.windowSize < maxBlockSize { + maxBlockSize = s.windowSize + } + for i := range seqs { + var ll, mo, ml int + if br.off > 4+((maxOffsetBits+16+16)>>3) { + // inlined function: + // ll, mo, ml = s.nextFast(br, llState, mlState, ofState) + + // Final will not read from stream. + var llB, mlB, moB uint8 + ll, llB = llState.final() + ml, mlB = mlState.final() + mo, moB = ofState.final() + + // extra bits are stored in reverse order. + br.fillFast() + mo += br.getBits(moB) + if s.maxBits > 32 { + br.fillFast() + } + ml += br.getBits(mlB) + ll += br.getBits(llB) + + if moB > 1 { + s.prevOffset[2] = s.prevOffset[1] + s.prevOffset[1] = s.prevOffset[0] + s.prevOffset[0] = mo + } else { + // mo = s.adjustOffset(mo, ll, moB) + // Inlined for rather big speedup + if ll == 0 { + // There is an exception though, when current sequence's literals_length = 0. + // In this case, repeated offsets are shifted by one, so an offset_value of 1 means Repeated_Offset2, + // an offset_value of 2 means Repeated_Offset3, and an offset_value of 3 means Repeated_Offset1 - 1_byte. + mo++ + } + + if mo == 0 { + mo = s.prevOffset[0] + } else { + var temp int + if mo == 3 { + temp = s.prevOffset[0] - 1 + } else { + temp = s.prevOffset[mo] + } + + if temp == 0 { + // 0 is not valid; input is corrupted; force offset to 1 + println("WARNING: temp was 0") + temp = 1 + } + + if mo != 1 { + s.prevOffset[2] = s.prevOffset[1] + } + s.prevOffset[1] = s.prevOffset[0] + s.prevOffset[0] = temp + mo = temp + } + } + br.fillFast() + } else { + if br.overread() { + if debugDecoder { + printf("reading sequence %d, exceeded available data\n", i) + } + return io.ErrUnexpectedEOF + } + ll, mo, ml = s.next(br, llState, mlState, ofState) + br.fill() + } + + if debugSequences { + println("Seq", i, "Litlen:", ll, "mo:", mo, "(abs) ml:", ml) + } + // Evaluate. + // We might be doing this async, so do it early. + if mo == 0 && ml > 0 { + return fmt.Errorf("zero matchoff and matchlen (%d) > 0", ml) + } + if ml > maxMatchLen { + return fmt.Errorf("match len (%d) bigger than max allowed length", ml) + } + s.seqSize += ll + ml + if s.seqSize > maxBlockSize { + return fmt.Errorf("output bigger than max block size (%d)", maxBlockSize) + } + litRemain -= ll + if litRemain < 0 { + return fmt.Errorf("unexpected literal count, want %d bytes, but only %d is available", ll, litRemain+ll) + } + seqs[i] = seqVals{ + ll: ll, + ml: ml, + mo: mo, + } + if i == len(seqs)-1 { + // This is the last sequence, so we shouldn't update state. + break + } + + // Manually inlined, ~ 5-20% faster + // Update all 3 states at once. Approx 20% faster. + nBits := llState.nbBits() + mlState.nbBits() + ofState.nbBits() + if nBits == 0 { + llState = llTable[llState.newState()&maxTableMask] + mlState = mlTable[mlState.newState()&maxTableMask] + ofState = ofTable[ofState.newState()&maxTableMask] + } else { + bits := br.get32BitsFast(nBits) + lowBits := uint16(bits >> ((ofState.nbBits() + mlState.nbBits()) & 31)) + llState = llTable[(llState.newState()+lowBits)&maxTableMask] + + lowBits = uint16(bits >> (ofState.nbBits() & 31)) + lowBits &= bitMask[mlState.nbBits()&15] + mlState = mlTable[(mlState.newState()+lowBits)&maxTableMask] + + lowBits = uint16(bits) & bitMask[ofState.nbBits()&15] + ofState = ofTable[(ofState.newState()+lowBits)&maxTableMask] + } + } + s.seqSize += litRemain + if s.seqSize > maxBlockSize { + return fmt.Errorf("output bigger than max block size (%d)", maxBlockSize) + } + err := br.close() + if err != nil { + printf("Closing sequences: %v, %+v\n", err, *br) + } + return err +} + +// executeSimple handles cases when a dictionary is not used. +func (s *sequenceDecs) executeSimple(seqs []seqVals, hist []byte) error { + // Ensure we have enough output size... + if len(s.out)+s.seqSize > cap(s.out) { + addBytes := s.seqSize + len(s.out) + s.out = append(s.out, make([]byte, addBytes)...) + s.out = s.out[:len(s.out)-addBytes] + } + + if debugDecoder { + printf("Execute %d seqs with literals: %d into %d bytes\n", len(seqs), len(s.literals), s.seqSize) + } + + var t = len(s.out) + out := s.out[:t+s.seqSize] + + for _, seq := range seqs { + // Add literals + copy(out[t:], s.literals[:seq.ll]) + t += seq.ll + s.literals = s.literals[seq.ll:] + + // Malformed input + if seq.mo > t+len(hist) || seq.mo > s.windowSize { + return fmt.Errorf("match offset (%d) bigger than current history (%d)", seq.mo, t+len(hist)) + } + + // Copy from history. + if v := seq.mo - t; v > 0 { + // v is the start position in history from end. + start := len(hist) - v + if seq.ml > v { + // Some goes into the current block. + // Copy remainder of history + copy(out[t:], hist[start:]) + t += v + seq.ml -= v + } else { + copy(out[t:], hist[start:start+seq.ml]) + t += seq.ml + continue + } + } + + // We must be in the current buffer now + if seq.ml > 0 { + start := t - seq.mo + if seq.ml <= t-start { + // No overlap + copy(out[t:], out[start:start+seq.ml]) + t += seq.ml + } else { + // Overlapping copy + // Extend destination slice and copy one byte at the time. + src := out[start : start+seq.ml] + dst := out[t:] + dst = dst[:len(src)] + t += len(src) + // Destination is the space we just added. + for i := range src { + dst[i] = src[i] + } + } + } + } + // Add final literals + copy(out[t:], s.literals) + if debugDecoder { + t += len(s.literals) + if t != len(out) { + panic(fmt.Errorf("length mismatch, want %d, got %d, ss: %d", len(out), t, s.seqSize)) + } + } + s.out = out + + return nil +} diff --git a/vendor/github.com/klauspost/compress/zstd/seqenc.go b/vendor/github.com/klauspost/compress/zstd/seqenc.go new file mode 100644 index 000000000..8014174a7 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/seqenc.go @@ -0,0 +1,114 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import "math/bits" + +type seqCoders struct { + llEnc, ofEnc, mlEnc *fseEncoder + llPrev, ofPrev, mlPrev *fseEncoder +} + +// swap coders with another (block). +func (s *seqCoders) swap(other *seqCoders) { + *s, *other = *other, *s +} + +// setPrev will update the previous encoders to the actually used ones +// and make sure a fresh one is in the main slot. +func (s *seqCoders) setPrev(ll, ml, of *fseEncoder) { + compareSwap := func(used *fseEncoder, current, prev **fseEncoder) { + // We used the new one, more current to history and reuse the previous history + if *current == used { + *prev, *current = *current, *prev + c := *current + p := *prev + c.reUsed = false + p.reUsed = true + return + } + if used == *prev { + return + } + // Ensure we cannot reuse by accident + prevEnc := *prev + prevEnc.symbolLen = 0 + } + compareSwap(ll, &s.llEnc, &s.llPrev) + compareSwap(ml, &s.mlEnc, &s.mlPrev) + compareSwap(of, &s.ofEnc, &s.ofPrev) +} + +func highBit(val uint32) (n uint32) { + return uint32(bits.Len32(val) - 1) +} + +var llCodeTable = [64]byte{0, 1, 2, 3, 4, 5, 6, 7, + 8, 9, 10, 11, 12, 13, 14, 15, + 16, 16, 17, 17, 18, 18, 19, 19, + 20, 20, 20, 20, 21, 21, 21, 21, + 22, 22, 22, 22, 22, 22, 22, 22, + 23, 23, 23, 23, 23, 23, 23, 23, + 24, 24, 24, 24, 24, 24, 24, 24, + 24, 24, 24, 24, 24, 24, 24, 24} + +// Up to 6 bits +const maxLLCode = 35 + +// llBitsTable translates from ll code to number of bits. +var llBitsTable = [maxLLCode + 1]byte{ + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 1, 1, 1, 1, 2, 2, 3, 3, + 4, 6, 7, 8, 9, 10, 11, 12, + 13, 14, 15, 16} + +// llCode returns the code that represents the literal length requested. +func llCode(litLength uint32) uint8 { + const llDeltaCode = 19 + if litLength <= 63 { + // Compiler insists on bounds check (Go 1.12) + return llCodeTable[litLength&63] + } + return uint8(highBit(litLength)) + llDeltaCode +} + +var mlCodeTable = [128]byte{0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, + 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, + 32, 32, 33, 33, 34, 34, 35, 35, 36, 36, 36, 36, 37, 37, 37, 37, + 38, 38, 38, 38, 38, 38, 38, 38, 39, 39, 39, 39, 39, 39, 39, 39, + 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, 40, + 41, 41, 41, 41, 41, 41, 41, 41, 41, 41, 41, 41, 41, 41, 41, 41, + 42, 42, 42, 42, 42, 42, 42, 42, 42, 42, 42, 42, 42, 42, 42, 42, + 42, 42, 42, 42, 42, 42, 42, 42, 42, 42, 42, 42, 42, 42, 42, 42} + +// Up to 6 bits +const maxMLCode = 52 + +// mlBitsTable translates from ml code to number of bits. +var mlBitsTable = [maxMLCode + 1]byte{ + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 0, 0, 0, 0, 0, 0, 0, 0, + 1, 1, 1, 1, 2, 2, 3, 3, + 4, 4, 5, 7, 8, 9, 10, 11, + 12, 13, 14, 15, 16} + +// note : mlBase = matchLength - MINMATCH; +// because it's the format it's stored in seqStore->sequences +func mlCode(mlBase uint32) uint8 { + const mlDeltaCode = 36 + if mlBase <= 127 { + // Compiler insists on bounds check (Go 1.12) + return mlCodeTable[mlBase&127] + } + return uint8(highBit(mlBase)) + mlDeltaCode +} + +func ofCode(offset uint32) uint8 { + // A valid offset will always be > 0. + return uint8(bits.Len32(offset) - 1) +} diff --git a/vendor/github.com/klauspost/compress/zstd/snappy.go b/vendor/github.com/klauspost/compress/zstd/snappy.go new file mode 100644 index 000000000..9e1baad73 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/snappy.go @@ -0,0 +1,435 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. +// Based on work by Yann Collet, released under BSD License. + +package zstd + +import ( + "encoding/binary" + "errors" + "hash/crc32" + "io" + + "github.com/klauspost/compress/huff0" + snappy "github.com/klauspost/compress/internal/snapref" +) + +const ( + snappyTagLiteral = 0x00 + snappyTagCopy1 = 0x01 + snappyTagCopy2 = 0x02 + snappyTagCopy4 = 0x03 +) + +const ( + snappyChecksumSize = 4 + snappyMagicBody = "sNaPpY" + + // snappyMaxBlockSize is the maximum size of the input to encodeBlock. It is not + // part of the wire format per se, but some parts of the encoder assume + // that an offset fits into a uint16. + // + // Also, for the framing format (Writer type instead of Encode function), + // https://github.com/google/snappy/blob/master/framing_format.txt says + // that "the uncompressed data in a chunk must be no longer than 65536 + // bytes". + snappyMaxBlockSize = 65536 + + // snappyMaxEncodedLenOfMaxBlockSize equals MaxEncodedLen(snappyMaxBlockSize), but is + // hard coded to be a const instead of a variable, so that obufLen can also + // be a const. Their equivalence is confirmed by + // TestMaxEncodedLenOfMaxBlockSize. + snappyMaxEncodedLenOfMaxBlockSize = 76490 +) + +const ( + chunkTypeCompressedData = 0x00 + chunkTypeUncompressedData = 0x01 + chunkTypePadding = 0xfe + chunkTypeStreamIdentifier = 0xff +) + +var ( + // ErrSnappyCorrupt reports that the input is invalid. + ErrSnappyCorrupt = errors.New("snappy: corrupt input") + // ErrSnappyTooLarge reports that the uncompressed length is too large. + ErrSnappyTooLarge = errors.New("snappy: decoded block is too large") + // ErrSnappyUnsupported reports that the input isn't supported. + ErrSnappyUnsupported = errors.New("snappy: unsupported input") + + errUnsupportedLiteralLength = errors.New("snappy: unsupported literal length") +) + +// SnappyConverter can read SnappyConverter-compressed streams and convert them to zstd. +// Conversion is done by converting the stream directly from Snappy without intermediate +// full decoding. +// Therefore the compression ratio is much less than what can be done by a full decompression +// and compression, and a faulty Snappy stream may lead to a faulty Zstandard stream without +// any errors being generated. +// No CRC value is being generated and not all CRC values of the Snappy stream are checked. +// However, it provides really fast recompression of Snappy streams. +// The converter can be reused to avoid allocations, even after errors. +type SnappyConverter struct { + r io.Reader + err error + buf []byte + block *blockEnc +} + +// Convert the Snappy stream supplied in 'in' and write the zStandard stream to 'w'. +// If any error is detected on the Snappy stream it is returned. +// The number of bytes written is returned. +func (r *SnappyConverter) Convert(in io.Reader, w io.Writer) (int64, error) { + initPredefined() + r.err = nil + r.r = in + if r.block == nil { + r.block = &blockEnc{} + r.block.init() + } + r.block.initNewEncode() + if len(r.buf) != snappyMaxEncodedLenOfMaxBlockSize+snappyChecksumSize { + r.buf = make([]byte, snappyMaxEncodedLenOfMaxBlockSize+snappyChecksumSize) + } + r.block.litEnc.Reuse = huff0.ReusePolicyNone + var written int64 + var readHeader bool + { + var header []byte + var n int + header, r.err = frameHeader{WindowSize: snappyMaxBlockSize}.appendTo(r.buf[:0]) + + n, r.err = w.Write(header) + if r.err != nil { + return written, r.err + } + written += int64(n) + } + + for { + if !r.readFull(r.buf[:4], true) { + // Add empty last block + r.block.reset(nil) + r.block.last = true + err := r.block.encodeLits(r.block.literals, false) + if err != nil { + return written, err + } + n, err := w.Write(r.block.output) + if err != nil { + return written, err + } + written += int64(n) + + return written, r.err + } + chunkType := r.buf[0] + if !readHeader { + if chunkType != chunkTypeStreamIdentifier { + println("chunkType != chunkTypeStreamIdentifier", chunkType) + r.err = ErrSnappyCorrupt + return written, r.err + } + readHeader = true + } + chunkLen := int(r.buf[1]) | int(r.buf[2])<<8 | int(r.buf[3])<<16 + if chunkLen > len(r.buf) { + println("chunkLen > len(r.buf)", chunkType) + r.err = ErrSnappyUnsupported + return written, r.err + } + + // The chunk types are specified at + // https://github.com/google/snappy/blob/master/framing_format.txt + switch chunkType { + case chunkTypeCompressedData: + // Section 4.2. Compressed data (chunk type 0x00). + if chunkLen < snappyChecksumSize { + println("chunkLen < snappyChecksumSize", chunkLen, snappyChecksumSize) + r.err = ErrSnappyCorrupt + return written, r.err + } + buf := r.buf[:chunkLen] + if !r.readFull(buf, false) { + return written, r.err + } + //checksum := uint32(buf[0]) | uint32(buf[1])<<8 | uint32(buf[2])<<16 | uint32(buf[3])<<24 + buf = buf[snappyChecksumSize:] + + n, hdr, err := snappyDecodedLen(buf) + if err != nil { + r.err = err + return written, r.err + } + buf = buf[hdr:] + if n > snappyMaxBlockSize { + println("n > snappyMaxBlockSize", n, snappyMaxBlockSize) + r.err = ErrSnappyCorrupt + return written, r.err + } + r.block.reset(nil) + r.block.pushOffsets() + if err := decodeSnappy(r.block, buf); err != nil { + r.err = err + return written, r.err + } + if r.block.size+r.block.extraLits != n { + printf("invalid size, want %d, got %d\n", n, r.block.size+r.block.extraLits) + r.err = ErrSnappyCorrupt + return written, r.err + } + err = r.block.encode(nil, false, false) + switch err { + case errIncompressible: + r.block.popOffsets() + r.block.reset(nil) + r.block.literals, err = snappy.Decode(r.block.literals[:n], r.buf[snappyChecksumSize:chunkLen]) + if err != nil { + return written, err + } + err = r.block.encodeLits(r.block.literals, false) + if err != nil { + return written, err + } + case nil: + default: + return written, err + } + + n, r.err = w.Write(r.block.output) + if r.err != nil { + return written, err + } + written += int64(n) + continue + case chunkTypeUncompressedData: + if debugEncoder { + println("Uncompressed, chunklen", chunkLen) + } + // Section 4.3. Uncompressed data (chunk type 0x01). + if chunkLen < snappyChecksumSize { + println("chunkLen < snappyChecksumSize", chunkLen, snappyChecksumSize) + r.err = ErrSnappyCorrupt + return written, r.err + } + r.block.reset(nil) + buf := r.buf[:snappyChecksumSize] + if !r.readFull(buf, false) { + return written, r.err + } + checksum := uint32(buf[0]) | uint32(buf[1])<<8 | uint32(buf[2])<<16 | uint32(buf[3])<<24 + // Read directly into r.decoded instead of via r.buf. + n := chunkLen - snappyChecksumSize + if n > snappyMaxBlockSize { + println("n > snappyMaxBlockSize", n, snappyMaxBlockSize) + r.err = ErrSnappyCorrupt + return written, r.err + } + r.block.literals = r.block.literals[:n] + if !r.readFull(r.block.literals, false) { + return written, r.err + } + if snappyCRC(r.block.literals) != checksum { + println("literals crc mismatch") + r.err = ErrSnappyCorrupt + return written, r.err + } + err := r.block.encodeLits(r.block.literals, false) + if err != nil { + return written, err + } + n, r.err = w.Write(r.block.output) + if r.err != nil { + return written, err + } + written += int64(n) + continue + + case chunkTypeStreamIdentifier: + if debugEncoder { + println("stream id", chunkLen, len(snappyMagicBody)) + } + // Section 4.1. Stream identifier (chunk type 0xff). + if chunkLen != len(snappyMagicBody) { + println("chunkLen != len(snappyMagicBody)", chunkLen, len(snappyMagicBody)) + r.err = ErrSnappyCorrupt + return written, r.err + } + if !r.readFull(r.buf[:len(snappyMagicBody)], false) { + return written, r.err + } + for i := 0; i < len(snappyMagicBody); i++ { + if r.buf[i] != snappyMagicBody[i] { + println("r.buf[i] != snappyMagicBody[i]", r.buf[i], snappyMagicBody[i], i) + r.err = ErrSnappyCorrupt + return written, r.err + } + } + continue + } + + if chunkType <= 0x7f { + // Section 4.5. Reserved unskippable chunks (chunk types 0x02-0x7f). + println("chunkType <= 0x7f") + r.err = ErrSnappyUnsupported + return written, r.err + } + // Section 4.4 Padding (chunk type 0xfe). + // Section 4.6. Reserved skippable chunks (chunk types 0x80-0xfd). + if !r.readFull(r.buf[:chunkLen], false) { + return written, r.err + } + } +} + +// decodeSnappy writes the decoding of src to dst. It assumes that the varint-encoded +// length of the decompressed bytes has already been read. +func decodeSnappy(blk *blockEnc, src []byte) error { + //decodeRef(make([]byte, snappyMaxBlockSize), src) + var s, length int + lits := blk.extraLits + var offset uint32 + for s < len(src) { + switch src[s] & 0x03 { + case snappyTagLiteral: + x := uint32(src[s] >> 2) + switch { + case x < 60: + s++ + case x == 60: + s += 2 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + println("uint(s) > uint(len(src)", s, src) + return ErrSnappyCorrupt + } + x = uint32(src[s-1]) + case x == 61: + s += 3 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + println("uint(s) > uint(len(src)", s, src) + return ErrSnappyCorrupt + } + x = uint32(src[s-2]) | uint32(src[s-1])<<8 + case x == 62: + s += 4 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + println("uint(s) > uint(len(src)", s, src) + return ErrSnappyCorrupt + } + x = uint32(src[s-3]) | uint32(src[s-2])<<8 | uint32(src[s-1])<<16 + case x == 63: + s += 5 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + println("uint(s) > uint(len(src)", s, src) + return ErrSnappyCorrupt + } + x = uint32(src[s-4]) | uint32(src[s-3])<<8 | uint32(src[s-2])<<16 | uint32(src[s-1])<<24 + } + if x > snappyMaxBlockSize { + println("x > snappyMaxBlockSize", x, snappyMaxBlockSize) + return ErrSnappyCorrupt + } + length = int(x) + 1 + if length <= 0 { + println("length <= 0 ", length) + + return errUnsupportedLiteralLength + } + //if length > snappyMaxBlockSize-d || uint32(length) > len(src)-s { + // return ErrSnappyCorrupt + //} + + blk.literals = append(blk.literals, src[s:s+length]...) + //println(length, "litLen") + lits += length + s += length + continue + + case snappyTagCopy1: + s += 2 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + println("uint(s) > uint(len(src)", s, len(src)) + return ErrSnappyCorrupt + } + length = 4 + int(src[s-2])>>2&0x7 + offset = uint32(src[s-2])&0xe0<<3 | uint32(src[s-1]) + + case snappyTagCopy2: + s += 3 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + println("uint(s) > uint(len(src)", s, len(src)) + return ErrSnappyCorrupt + } + length = 1 + int(src[s-3])>>2 + offset = uint32(src[s-2]) | uint32(src[s-1])<<8 + + case snappyTagCopy4: + s += 5 + if uint(s) > uint(len(src)) { // The uint conversions catch overflow from the previous line. + println("uint(s) > uint(len(src)", s, len(src)) + return ErrSnappyCorrupt + } + length = 1 + int(src[s-5])>>2 + offset = uint32(src[s-4]) | uint32(src[s-3])<<8 | uint32(src[s-2])<<16 | uint32(src[s-1])<<24 + } + + if offset <= 0 || blk.size+lits < int(offset) /*|| length > len(blk)-d */ { + println("offset <= 0 || blk.size+lits < int(offset)", offset, blk.size+lits, int(offset), blk.size, lits) + + return ErrSnappyCorrupt + } + + // Check if offset is one of the recent offsets. + // Adjusts the output offset accordingly. + // Gives a tiny bit of compression, typically around 1%. + if false { + offset = blk.matchOffset(offset, uint32(lits)) + } else { + offset += 3 + } + + blk.sequences = append(blk.sequences, seq{ + litLen: uint32(lits), + offset: offset, + matchLen: uint32(length) - zstdMinMatch, + }) + blk.size += length + lits + lits = 0 + } + blk.extraLits = lits + return nil +} + +func (r *SnappyConverter) readFull(p []byte, allowEOF bool) (ok bool) { + if _, r.err = io.ReadFull(r.r, p); r.err != nil { + if r.err == io.ErrUnexpectedEOF || (r.err == io.EOF && !allowEOF) { + r.err = ErrSnappyCorrupt + } + return false + } + return true +} + +var crcTable = crc32.MakeTable(crc32.Castagnoli) + +// crc implements the checksum specified in section 3 of +// https://github.com/google/snappy/blob/master/framing_format.txt +func snappyCRC(b []byte) uint32 { + c := crc32.Update(0, crcTable, b) + return c>>15 | c<<17 + 0xa282ead8 +} + +// snappyDecodedLen returns the length of the decoded block and the number of bytes +// that the length header occupied. +func snappyDecodedLen(src []byte) (blockLen, headerLen int, err error) { + v, n := binary.Uvarint(src) + if n <= 0 || v > 0xffffffff { + return 0, 0, ErrSnappyCorrupt + } + + const wordSize = 32 << (^uint(0) >> 32 & 1) + if wordSize == 32 && v > 0x7fffffff { + return 0, 0, ErrSnappyTooLarge + } + return int(v), n, nil +} diff --git a/vendor/github.com/klauspost/compress/zstd/zip.go b/vendor/github.com/klauspost/compress/zstd/zip.go new file mode 100644 index 000000000..29c15c8c4 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/zip.go @@ -0,0 +1,141 @@ +// Copyright 2019+ Klaus Post. All rights reserved. +// License information can be found in the LICENSE file. + +package zstd + +import ( + "errors" + "io" + "sync" +) + +// ZipMethodWinZip is the method for Zstandard compressed data inside Zip files for WinZip. +// See https://www.winzip.com/win/en/comp_info.html +const ZipMethodWinZip = 93 + +// ZipMethodPKWare is the original method number used by PKWARE to indicate Zstandard compression. +// Deprecated: This has been deprecated by PKWARE, use ZipMethodWinZip instead for compression. +// See https://pkware.cachefly.net/webdocs/APPNOTE/APPNOTE-6.3.9.TXT +const ZipMethodPKWare = 20 + +// zipReaderPool is the default reader pool. +var zipReaderPool = sync.Pool{New: func() interface{} { + z, err := NewReader(nil, WithDecoderLowmem(true), WithDecoderMaxWindow(128<<20), WithDecoderConcurrency(1)) + if err != nil { + panic(err) + } + return z +}} + +// newZipReader creates a pooled zip decompressor. +func newZipReader(opts ...DOption) func(r io.Reader) io.ReadCloser { + pool := &zipReaderPool + if len(opts) > 0 { + opts = append([]DOption{WithDecoderLowmem(true), WithDecoderMaxWindow(128 << 20)}, opts...) + // Force concurrency 1 + opts = append(opts, WithDecoderConcurrency(1)) + // Create our own pool + pool = &sync.Pool{} + } + return func(r io.Reader) io.ReadCloser { + dec, ok := pool.Get().(*Decoder) + if ok { + dec.Reset(r) + } else { + d, err := NewReader(r, opts...) + if err != nil { + panic(err) + } + dec = d + } + return &pooledZipReader{dec: dec, pool: pool} + } +} + +type pooledZipReader struct { + mu sync.Mutex // guards Close and Read + pool *sync.Pool + dec *Decoder +} + +func (r *pooledZipReader) Read(p []byte) (n int, err error) { + r.mu.Lock() + defer r.mu.Unlock() + if r.dec == nil { + return 0, errors.New("read after close or EOF") + } + dec, err := r.dec.Read(p) + if err == io.EOF { + r.dec.Reset(nil) + r.pool.Put(r.dec) + r.dec = nil + } + return dec, err +} + +func (r *pooledZipReader) Close() error { + r.mu.Lock() + defer r.mu.Unlock() + var err error + if r.dec != nil { + err = r.dec.Reset(nil) + r.pool.Put(r.dec) + r.dec = nil + } + return err +} + +type pooledZipWriter struct { + mu sync.Mutex // guards Close and Read + enc *Encoder + pool *sync.Pool +} + +func (w *pooledZipWriter) Write(p []byte) (n int, err error) { + w.mu.Lock() + defer w.mu.Unlock() + if w.enc == nil { + return 0, errors.New("Write after Close") + } + return w.enc.Write(p) +} + +func (w *pooledZipWriter) Close() error { + w.mu.Lock() + defer w.mu.Unlock() + var err error + if w.enc != nil { + err = w.enc.Close() + w.pool.Put(w.enc) + w.enc = nil + } + return err +} + +// ZipCompressor returns a compressor that can be registered with zip libraries. +// The provided encoder options will be used on all encodes. +func ZipCompressor(opts ...EOption) func(w io.Writer) (io.WriteCloser, error) { + var pool sync.Pool + return func(w io.Writer) (io.WriteCloser, error) { + enc, ok := pool.Get().(*Encoder) + if ok { + enc.Reset(w) + } else { + var err error + enc, err = NewWriter(w, opts...) + if err != nil { + return nil, err + } + } + return &pooledZipWriter{enc: enc, pool: &pool}, nil + } +} + +// ZipDecompressor returns a decompressor that can be registered with zip libraries. +// See ZipCompressor for example. +// Options can be specified. WithDecoderConcurrency(1) is forced, +// and by default a 128MB maximum decompression window is specified. +// The window size can be overridden if required. +func ZipDecompressor(opts ...DOption) func(r io.Reader) io.ReadCloser { + return newZipReader(opts...) +} diff --git a/vendor/github.com/klauspost/compress/zstd/zstd.go b/vendor/github.com/klauspost/compress/zstd/zstd.go new file mode 100644 index 000000000..4be7cc736 --- /dev/null +++ b/vendor/github.com/klauspost/compress/zstd/zstd.go @@ -0,0 +1,121 @@ +// Package zstd provides decompression of zstandard files. +// +// For advanced usage and examples, go to the README: https://github.com/klauspost/compress/tree/master/zstd#zstd +package zstd + +import ( + "bytes" + "encoding/binary" + "errors" + "log" + "math" +) + +// enable debug printing +const debug = false + +// enable encoding debug printing +const debugEncoder = debug + +// enable decoding debug printing +const debugDecoder = debug + +// Enable extra assertions. +const debugAsserts = debug || false + +// print sequence details +const debugSequences = false + +// print detailed matching information +const debugMatches = false + +// force encoder to use predefined tables. +const forcePreDef = false + +// zstdMinMatch is the minimum zstd match length. +const zstdMinMatch = 3 + +// fcsUnknown is used for unknown frame content size. +const fcsUnknown = math.MaxUint64 + +var ( + // ErrReservedBlockType is returned when a reserved block type is found. + // Typically this indicates wrong or corrupted input. + ErrReservedBlockType = errors.New("invalid input: reserved block type encountered") + + // ErrCompressedSizeTooBig is returned when a block is bigger than allowed. + // Typically this indicates wrong or corrupted input. + ErrCompressedSizeTooBig = errors.New("invalid input: compressed size too big") + + // ErrBlockTooSmall is returned when a block is too small to be decoded. + // Typically returned on invalid input. + ErrBlockTooSmall = errors.New("block too small") + + // ErrUnexpectedBlockSize is returned when a block has unexpected size. + // Typically returned on invalid input. + ErrUnexpectedBlockSize = errors.New("unexpected block size") + + // ErrMagicMismatch is returned when a "magic" number isn't what is expected. + // Typically this indicates wrong or corrupted input. + ErrMagicMismatch = errors.New("invalid input: magic number mismatch") + + // ErrWindowSizeExceeded is returned when a reference exceeds the valid window size. + // Typically this indicates wrong or corrupted input. + ErrWindowSizeExceeded = errors.New("window size exceeded") + + // ErrWindowSizeTooSmall is returned when no window size is specified. + // Typically this indicates wrong or corrupted input. + ErrWindowSizeTooSmall = errors.New("invalid input: window size was too small") + + // ErrDecoderSizeExceeded is returned if decompressed size exceeds the configured limit. + ErrDecoderSizeExceeded = errors.New("decompressed size exceeds configured limit") + + // ErrUnknownDictionary is returned if the dictionary ID is unknown. + ErrUnknownDictionary = errors.New("unknown dictionary") + + // ErrFrameSizeExceeded is returned if the stated frame size is exceeded. + // This is only returned if SingleSegment is specified on the frame. + ErrFrameSizeExceeded = errors.New("frame size exceeded") + + // ErrFrameSizeMismatch is returned if the stated frame size does not match the expected size. + // This is only returned if SingleSegment is specified on the frame. + ErrFrameSizeMismatch = errors.New("frame size does not match size on stream") + + // ErrCRCMismatch is returned if CRC mismatches. + ErrCRCMismatch = errors.New("CRC check failed") + + // ErrDecoderClosed will be returned if the Decoder was used after + // Close has been called. + ErrDecoderClosed = errors.New("decoder used after Close") + + // ErrDecoderNilInput is returned when a nil Reader was provided + // and an operation other than Reset/DecodeAll/Close was attempted. + ErrDecoderNilInput = errors.New("nil input provided as reader") +) + +func println(a ...interface{}) { + if debug || debugDecoder || debugEncoder { + log.Println(a...) + } +} + +func printf(format string, a ...interface{}) { + if debug || debugDecoder || debugEncoder { + log.Printf(format, a...) + } +} + +func load3232(b []byte, i int32) uint32 { + return binary.LittleEndian.Uint32(b[:len(b):len(b)][i:]) +} + +func load6432(b []byte, i int32) uint64 { + return binary.LittleEndian.Uint64(b[:len(b):len(b)][i:]) +} + +type byter interface { + Bytes() []byte + Len() int +} + +var _ byter = &bytes.Buffer{} diff --git a/vendor/github.com/klauspost/cpuid/v2/.gitignore b/vendor/github.com/klauspost/cpuid/v2/.gitignore new file mode 100644 index 000000000..daf913b1b --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/.gitignore @@ -0,0 +1,24 @@ +# Compiled Object files, Static and Dynamic libs (Shared Objects) +*.o +*.a +*.so + +# Folders +_obj +_test + +# Architecture specific extensions/prefixes +*.[568vq] +[568vq].out + +*.cgo1.go +*.cgo2.c +_cgo_defun.c +_cgo_gotypes.go +_cgo_export.* + +_testmain.go + +*.exe +*.test +*.prof diff --git a/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml b/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml new file mode 100644 index 000000000..944cc0007 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/.goreleaser.yml @@ -0,0 +1,74 @@ +# This is an example goreleaser.yaml file with some sane defaults. +# Make sure to check the documentation at http://goreleaser.com + +builds: + - + id: "cpuid" + binary: cpuid + main: ./cmd/cpuid/main.go + env: + - CGO_ENABLED=0 + flags: + - -ldflags=-s -w + goos: + - aix + - linux + - freebsd + - netbsd + - windows + - darwin + goarch: + - 386 + - amd64 + - arm64 + goarm: + - 7 + +archives: + - + id: cpuid + name_template: "cpuid-{{ .Os }}_{{ .Arch }}_{{ .Version }}" + replacements: + aix: AIX + darwin: OSX + linux: Linux + windows: Windows + 386: i386 + amd64: x86_64 + freebsd: FreeBSD + netbsd: NetBSD + format_overrides: + - goos: windows + format: zip + files: + - LICENSE +checksum: + name_template: 'checksums.txt' +snapshot: + name_template: "{{ .Tag }}-next" +changelog: + sort: asc + filters: + exclude: + - '^doc:' + - '^docs:' + - '^test:' + - '^tests:' + - '^Update\sREADME.md' + +nfpms: + - + file_name_template: "cpuid_package_{{ .Version }}_{{ .Os }}_{{ .Arch }}" + vendor: Klaus Post + homepage: https://github.com/klauspost/cpuid + maintainer: Klaus Post + description: CPUID Tool + license: BSD 3-Clause + formats: + - deb + - rpm + replacements: + darwin: Darwin + linux: Linux + freebsd: FreeBSD + amd64: x86_64 diff --git a/vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt b/vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt new file mode 100644 index 000000000..452d28eda --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/CONTRIBUTING.txt @@ -0,0 +1,35 @@ +Developer Certificate of Origin +Version 1.1 + +Copyright (C) 2015- Klaus Post & Contributors. +Email: klauspost@gmail.com + +Everyone is permitted to copy and distribute verbatim copies of this +license document, but changing it is not allowed. + + +Developer's Certificate of Origin 1.1 + +By making a contribution to this project, I certify that: + +(a) The contribution was created in whole or in part by me and I + have the right to submit it under the open source license + indicated in the file; or + +(b) The contribution is based upon previous work that, to the best + of my knowledge, is covered under an appropriate open source + license and I have the right under that license to submit that + work with modifications, whether created in whole or in part + by me, under the same open source license (unless I am + permitted to submit under a different license), as indicated + in the file; or + +(c) The contribution was provided directly to me by some other + person who certified (a), (b) or (c) and I have not modified + it. + +(d) I understand and agree that this project and the contribution + are public and that a record of the contribution (including all + personal information I submit with it, including my sign-off) is + maintained indefinitely and may be redistributed consistent with + this project or the open source license(s) involved. diff --git a/vendor/github.com/klauspost/cpuid/v2/LICENSE b/vendor/github.com/klauspost/cpuid/v2/LICENSE new file mode 100644 index 000000000..5cec7ee94 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/LICENSE @@ -0,0 +1,22 @@ +The MIT License (MIT) + +Copyright (c) 2015 Klaus Post + +Permission is hereby granted, free of charge, to any person obtaining a copy +of this software and associated documentation files (the "Software"), to deal +in the Software without restriction, including without limitation the rights +to use, copy, modify, merge, publish, distribute, sublicense, and/or sell +copies of the Software, and to permit persons to whom the Software is +furnished to do so, subject to the following conditions: + +The above copyright notice and this permission notice shall be included in all +copies or substantial portions of the Software. + +THE SOFTWARE IS PROVIDED "AS IS", WITHOUT WARRANTY OF ANY KIND, EXPRESS OR +IMPLIED, INCLUDING BUT NOT LIMITED TO THE WARRANTIES OF MERCHANTABILITY, +FITNESS FOR A PARTICULAR PURPOSE AND NONINFRINGEMENT. IN NO EVENT SHALL THE +AUTHORS OR COPYRIGHT HOLDERS BE LIABLE FOR ANY CLAIM, DAMAGES OR OTHER +LIABILITY, WHETHER IN AN ACTION OF CONTRACT, TORT OR OTHERWISE, ARISING FROM, +OUT OF OR IN CONNECTION WITH THE SOFTWARE OR THE USE OR OTHER DEALINGS IN THE +SOFTWARE. + diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md new file mode 100644 index 000000000..accd7abaf --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -0,0 +1,493 @@ +# cpuid +Package cpuid provides information about the CPU running the current program. + +CPU features are detected on startup, and kept for fast access through the life of the application. +Currently x86 / x64 (AMD64/i386) and ARM (ARM64) is supported, and no external C (cgo) code is used, which should make the library very easy to use. + +You can access the CPU information by accessing the shared CPU variable of the cpuid library. + +Package home: https://github.com/klauspost/cpuid + +[![PkgGoDev](https://pkg.go.dev/badge/github.com/klauspost/cpuid)](https://pkg.go.dev/github.com/klauspost/cpuid/v2) +[![Build Status][3]][4] + +[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master +[4]: https://travis-ci.org/klauspost/cpuid + +## installing + +`go get -u github.com/klauspost/cpuid/v2` using modules. +Drop `v2` for others. + +Installing binary: + +`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest` + +Or download binaries from release page: https://github.com/klauspost/cpuid/releases + +### Homebrew + +For macOS/Linux users, you can install via [brew](https://brew.sh/) + +```sh +$ brew install cpuid +``` + +## example + +```Go +package main + +import ( + "fmt" + "strings" + + . "github.com/klauspost/cpuid/v2" +) + +func main() { + // Print basic CPU information: + fmt.Println("Name:", CPU.BrandName) + fmt.Println("PhysicalCores:", CPU.PhysicalCores) + fmt.Println("ThreadsPerCore:", CPU.ThreadsPerCore) + fmt.Println("LogicalCores:", CPU.LogicalCores) + fmt.Println("Family", CPU.Family, "Model:", CPU.Model, "Vendor ID:", CPU.VendorID) + fmt.Println("Features:", strings.Join(CPU.FeatureSet(), ",")) + fmt.Println("Cacheline bytes:", CPU.CacheLine) + fmt.Println("L1 Data Cache:", CPU.Cache.L1D, "bytes") + fmt.Println("L1 Instruction Cache:", CPU.Cache.L1I, "bytes") + fmt.Println("L2 Cache:", CPU.Cache.L2, "bytes") + fmt.Println("L3 Cache:", CPU.Cache.L3, "bytes") + fmt.Println("Frequency", CPU.Hz, "hz") + + // Test if we have these specific features: + if CPU.Supports(SSE, SSE2) { + fmt.Println("We have Streaming SIMD 2 Extensions") + } +} +``` + +Sample output: +``` +>go run main.go +Name: AMD Ryzen 9 3950X 16-Core Processor +PhysicalCores: 16 +ThreadsPerCore: 2 +LogicalCores: 32 +Family 23 Model: 113 Vendor ID: AMD +Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CMOV,CX16,F16C,FMA3,HTT,HYPERVISOR,LZCNT,MMX,MMXEXT,NX,POPCNT,RDRAND,RDSEED,RDTSCP,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3 +Cacheline bytes: 64 +L1 Data Cache: 32768 bytes +L1 Instruction Cache: 32768 bytes +L2 Cache: 524288 bytes +L3 Cache: 16777216 bytes +Frequency 0 hz +We have Streaming SIMD 2 Extensions +``` + +# usage + +The `cpuid.CPU` provides access to CPU features. Use `cpuid.CPU.Supports()` to check for CPU features. +A faster `cpuid.CPU.Has()` is provided which will usually be inlined by the gc compiler. + +To test a larger number of features, they can be combined using `f := CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SYSCALL, SSE, SSE2)`, etc. +This can be using with `cpuid.CPU.HasAll(f)` to quickly test if all features are supported. + +Note that for some cpu/os combinations some features will not be detected. +`amd64` has rather good support and should work reliably on all platforms. + +Note that hypervisors may not pass through all CPU features through to the guest OS, +so even if your host supports a feature it may not be visible on guests. + +## arm64 feature detection + +Not all operating systems provide ARM features directly +and there is no safe way to do so for the rest. + +Currently `arm64/linux` and `arm64/freebsd` should be quite reliable. +`arm64/darwin` adds features expected from the M1 processor, but a lot remains undetected. + +A `DetectARM()` can be used if you are able to control your deployment, +it will detect CPU features, but may crash if the OS doesn't intercept the calls. +A `-cpu.arm` flag for detecting unsafe ARM features can be added. See below. + +Note that currently only features are detected on ARM, +no additional information is currently available. + +## flags + +It is possible to add flags that affects cpu detection. + +For this the `Flags()` command is provided. + +This must be called *before* `flag.Parse()` AND after the flags have been parsed `Detect()` must be called. + +This means that any detection used in `init()` functions will not contain these flags. + +Example: + +```Go +package main + +import ( + "flag" + "fmt" + "strings" + + "github.com/klauspost/cpuid/v2" +) + +func main() { + cpuid.Flags() + flag.Parse() + cpuid.Detect() + + // Test if we have these specific features: + if cpuid.CPU.Supports(cpuid.SSE, cpuid.SSE2) { + fmt.Println("We have Streaming SIMD 2 Extensions") + } +} +``` + +## commandline + +Download as binary from: https://github.com/klauspost/cpuid/releases + +Install from source: + +`go install github.com/klauspost/cpuid/v2/cmd/cpuid@latest` + +### Example + +``` +λ cpuid +Name: AMD Ryzen 9 3950X 16-Core Processor +Vendor String: AuthenticAMD +Vendor ID: AMD +PhysicalCores: 16 +Threads Per Core: 2 +Logical Cores: 32 +CPU Family 23 Model: 113 +Features: ADX,AESNI,AVX,AVX2,BMI1,BMI2,CLMUL,CLZERO,CMOV,CMPXCHG8,CPBOOST,CX16,F16C,FMA3,FXSR,FXSROPT,HTT,HYPERVISOR,LAHF,LZCNT,MCAOVERFLOW,MMX,MMXEXT,MOVBE,NX,OSXSAVE,POPCNT,RDRAND,RDSEED,RDTSCP,SCE,SHA,SSE,SSE2,SSE3,SSE4,SSE42,SSE4A,SSSE3,SUCCOR,X87,XSAVE +Microarchitecture level: 3 +Cacheline bytes: 64 +L1 Instruction Cache: 32768 bytes +L1 Data Cache: 32768 bytes +L2 Cache: 524288 bytes +L3 Cache: 16777216 bytes + +``` +### JSON Output: + +``` +λ cpuid --json +{ + "BrandName": "AMD Ryzen 9 3950X 16-Core Processor", + "VendorID": 2, + "VendorString": "AuthenticAMD", + "PhysicalCores": 16, + "ThreadsPerCore": 2, + "LogicalCores": 32, + "Family": 23, + "Model": 113, + "CacheLine": 64, + "Hz": 0, + "BoostFreq": 0, + "Cache": { + "L1I": 32768, + "L1D": 32768, + "L2": 524288, + "L3": 16777216 + }, + "SGX": { + "Available": false, + "LaunchControl": false, + "SGX1Supported": false, + "SGX2Supported": false, + "MaxEnclaveSizeNot64": 0, + "MaxEnclaveSize64": 0, + "EPCSections": null + }, + "Features": [ + "ADX", + "AESNI", + "AVX", + "AVX2", + "BMI1", + "BMI2", + "CLMUL", + "CLZERO", + "CMOV", + "CMPXCHG8", + "CPBOOST", + "CX16", + "F16C", + "FMA3", + "FXSR", + "FXSROPT", + "HTT", + "HYPERVISOR", + "LAHF", + "LZCNT", + "MCAOVERFLOW", + "MMX", + "MMXEXT", + "MOVBE", + "NX", + "OSXSAVE", + "POPCNT", + "RDRAND", + "RDSEED", + "RDTSCP", + "SCE", + "SHA", + "SSE", + "SSE2", + "SSE3", + "SSE4", + "SSE42", + "SSE4A", + "SSSE3", + "SUCCOR", + "X87", + "XSAVE" + ], + "X64Level": 3 +} +``` + +### Check CPU microarch level + +``` +λ cpuid --check-level=3 +2022/03/18 17:04:40 AMD Ryzen 9 3950X 16-Core Processor +2022/03/18 17:04:40 Microarchitecture level 3 is supported. Max level is 3. +Exit Code 0 + +λ cpuid --check-level=4 +2022/03/18 17:06:18 AMD Ryzen 9 3950X 16-Core Processor +2022/03/18 17:06:18 Microarchitecture level 4 not supported. Max level is 3. +Exit Code 1 +``` + + +## Available flags + +### x86 & amd64 + +| Feature Flag | Description | +|--------------------|------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------| +| ADX | Intel ADX (Multi-Precision Add-Carry Instruction Extensions) | +| AESNI | Advanced Encryption Standard New Instructions | +| AMD3DNOW | AMD 3DNOW | +| AMD3DNOWEXT | AMD 3DNowExt | +| AMXBF16 | Tile computational operations on BFLOAT16 numbers | +| AMXINT8 | Tile computational operations on 8-bit integers | +| AMXFP16 | Tile computational operations on FP16 numbers | +| AMXTILE | Tile architecture | +| AVX | AVX functions | +| AVX2 | AVX2 functions | +| AVX512BF16 | AVX-512 BFLOAT16 Instructions | +| AVX512BITALG | AVX-512 Bit Algorithms | +| AVX512BW | AVX-512 Byte and Word Instructions | +| AVX512CD | AVX-512 Conflict Detection Instructions | +| AVX512DQ | AVX-512 Doubleword and Quadword Instructions | +| AVX512ER | AVX-512 Exponential and Reciprocal Instructions | +| AVX512F | AVX-512 Foundation | +| AVX512FP16 | AVX-512 FP16 Instructions | +| AVX512IFMA | AVX-512 Integer Fused Multiply-Add Instructions | +| AVX512PF | AVX-512 Prefetch Instructions | +| AVX512VBMI | AVX-512 Vector Bit Manipulation Instructions | +| AVX512VBMI2 | AVX-512 Vector Bit Manipulation Instructions, Version 2 | +| AVX512VL | AVX-512 Vector Length Extensions | +| AVX512VNNI | AVX-512 Vector Neural Network Instructions | +| AVX512VP2INTERSECT | AVX-512 Intersect for D/Q | +| AVX512VPOPCNTDQ | AVX-512 Vector Population Count Doubleword and Quadword | +| AVXIFMA | AVX-IFMA instructions | +| AVXNECONVERT | AVX-NE-CONVERT instructions | +| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one | +| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions | +| AVXVNNIINT8 | AVX-VNNI-INT8 instructions | +| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 | +| BMI1 | Bit Manipulation Instruction Set 1 | +| BMI2 | Bit Manipulation Instruction Set 2 | +| CETIBT | Intel CET Indirect Branch Tracking | +| CETSS | Intel CET Shadow Stack | +| CLDEMOTE | Cache Line Demote | +| CLMUL | Carry-less Multiplication | +| CLZERO | CLZERO instruction supported | +| CMOV | i686 CMOV | +| CMPCCXADD | CMPCCXADD instructions | +| CMPSB_SCADBS_SHORT | Fast short CMPSB and SCASB | +| CMPXCHG8 | CMPXCHG8 instruction | +| CPBOOST | Core Performance Boost | +| CPPC | AMD: Collaborative Processor Performance Control | +| CX16 | CMPXCHG16B Instruction | +| EFER_LMSLE_UNS | AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ | +| ENQCMD | Enqueue Command | +| ERMS | Enhanced REP MOVSB/STOSB | +| F16C | Half-precision floating-point conversion | +| FLUSH_L1D | Flush L1D cache | +| FMA3 | Intel FMA 3. Does not imply AVX. | +| FMA4 | Bulldozer FMA4 functions | +| FP128 | AMD: When set, the internal FP/SIMD execution datapath is 128-bits wide | +| FP256 | AMD: When set, the internal FP/SIMD execution datapath is 256-bits wide | +| FSRM | Fast Short Rep Mov | +| FXSR | FXSAVE, FXRESTOR instructions, CR4 bit 9 | +| FXSROPT | FXSAVE/FXRSTOR optimizations | +| GFNI | Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. | +| HLE | Hardware Lock Elision | +| HRESET | If set CPU supports history reset and the IA32_HRESET_ENABLE MSR | +| HTT | Hyperthreading (enabled) | +| HWA | Hardware assert supported. Indicates support for MSRC001_10 | +| HYBRID_CPU | This part has CPUs of more than one type. | +| HYPERVISOR | This bit has been reserved by Intel & AMD for use by hypervisors | +| IA32_ARCH_CAP | IA32_ARCH_CAPABILITIES MSR (Intel) | +| IA32_CORE_CAP | IA32_CORE_CAPABILITIES MSR | +| IBPB | Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) | +| IBRS | AMD: Indirect Branch Restricted Speculation | +| IBRS_PREFERRED | AMD: IBRS is preferred over software solution | +| IBRS_PROVIDES_SMP | AMD: IBRS provides Same Mode Protection | +| IBS | Instruction Based Sampling (AMD) | +| IBSBRNTRGT | Instruction Based Sampling Feature (AMD) | +| IBSFETCHSAM | Instruction Based Sampling Feature (AMD) | +| IBSFFV | Instruction Based Sampling Feature (AMD) | +| IBSOPCNT | Instruction Based Sampling Feature (AMD) | +| IBSOPCNTEXT | Instruction Based Sampling Feature (AMD) | +| IBSOPSAM | Instruction Based Sampling Feature (AMD) | +| IBSRDWROPCNT | Instruction Based Sampling Feature (AMD) | +| IBSRIPINVALIDCHK | Instruction Based Sampling Feature (AMD) | +| IBS_FETCH_CTLX | AMD: IBS fetch control extended MSR supported | +| IBS_OPDATA4 | AMD: IBS op data 4 MSR supported | +| IBS_OPFUSE | AMD: Indicates support for IbsOpFuse | +| IBS_PREVENTHOST | Disallowing IBS use by the host supported | +| IBS_ZEN4 | Fetch and Op IBS support IBS extensions added with Zen4 | +| IDPRED_CTRL | IPRED_DIS | +| INT_WBINVD | WBINVD/WBNOINVD are interruptible. | +| INVLPGB | NVLPGB and TLBSYNC instruction supported | +| LAHF | LAHF/SAHF in long mode | +| LAM | If set, CPU supports Linear Address Masking | +| LBRVIRT | LBR virtualization | +| LZCNT | LZCNT instruction | +| MCAOVERFLOW | MCA overflow recovery support. | +| MCDT_NO | Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. | +| MCOMMIT | MCOMMIT instruction supported | +| MD_CLEAR | VERW clears CPU buffers | +| MMX | standard MMX | +| MMXEXT | SSE integer functions or AMD MMX ext | +| MOVBE | MOVBE instruction (big-endian) | +| MOVDIR64B | Move 64 Bytes as Direct Store | +| MOVDIRI | Move Doubleword as Direct Store | +| MOVSB_ZL | Fast Zero-Length MOVSB | +| MPX | Intel MPX (Memory Protection Extensions) | +| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | +| MSRIRC | Instruction Retired Counter MSR available | +| MSRLIST | Read/Write List of Model Specific Registers | +| MSR_PAGEFLUSH | Page Flush MSR available | +| NRIPS | Indicates support for NRIP save on VMEXIT | +| NX | NX (No-Execute) bit | +| OSXSAVE | XSAVE enabled by OS | +| PCONFIG | PCONFIG for Intel Multi-Key Total Memory Encryption | +| POPCNT | POPCNT instruction | +| PPIN | AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled | +| PREFETCHI | PREFETCHIT0/1 instructions | +| PSFD | Predictive Store Forward Disable | +| RDPRU | RDPRU instruction supported | +| RDRAND | RDRAND instruction is available | +| RDSEED | RDSEED instruction is available | +| RDTSCP | RDTSCP Instruction | +| RRSBA_CTRL | Restricted RSB Alternate | +| RTM | Restricted Transactional Memory | +| RTM_ALWAYS_ABORT | Indicates that the loaded microcode is forcing RTM abort. | +| SERIALIZE | Serialize Instruction Execution | +| SEV | AMD Secure Encrypted Virtualization supported | +| SEV_64BIT | AMD SEV guest execution only allowed from a 64-bit host | +| SEV_ALTERNATIVE | AMD SEV Alternate Injection supported | +| SEV_DEBUGSWAP | Full debug state swap supported for SEV-ES guests | +| SEV_ES | AMD SEV Encrypted State supported | +| SEV_RESTRICTED | AMD SEV Restricted Injection supported | +| SEV_SNP | AMD SEV Secure Nested Paging supported | +| SGX | Software Guard Extensions | +| SGXLC | Software Guard Extensions Launch Control | +| SHA | Intel SHA Extensions | +| SME | AMD Secure Memory Encryption supported | +| SME_COHERENT | AMD Hardware cache coherency across encryption domains enforced | +| SPEC_CTRL_SSBD | Speculative Store Bypass Disable | +| SRBDS_CTRL | SRBDS mitigation MSR available | +| SSE | SSE functions | +| SSE2 | P4 SSE functions | +| SSE3 | Prescott SSE3 functions | +| SSE4 | Penryn SSE4.1 functions | +| SSE42 | Nehalem SSE4.2 functions | +| SSE4A | AMD Barcelona microarchitecture SSE4a instructions | +| SSSE3 | Conroe SSSE3 functions | +| STIBP | Single Thread Indirect Branch Predictors | +| STIBP_ALWAYSON | AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On | +| STOSB_SHORT | Fast short STOSB | +| SUCCOR | Software uncorrectable error containment and recovery capability. | +| SVM | AMD Secure Virtual Machine | +| SVMDA | Indicates support for the SVM decode assists. | +| SVMFBASID | SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control | +| SVML | AMD SVM lock. Indicates support for SVM-Lock. | +| SVMNP | AMD SVM nested paging | +| SVMPF | SVM pause intercept filter. Indicates support for the pause intercept filter | +| SVMPFT | SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold | +| SYSCALL | System-Call Extension (SCE): SYSCALL and SYSRET instructions. | +| SYSEE | SYSENTER and SYSEXIT instructions | +| TBM | AMD Trailing Bit Manipulation | +| TDX_GUEST | Intel Trust Domain Extensions Guest | +| TLB_FLUSH_NESTED | AMD: Flushing includes all the nested translations for guest translations | +| TME | Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. | +| TOPEXT | TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. | +| TSCRATEMSR | MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 | +| TSXLDTRK | Intel TSX Suspend Load Address Tracking | +| VAES | Vector AES. AVX(512) versions requires additional checks. | +| VMCBCLEAN | VMCB clean bits. Indicates support for VMCB clean bits. | +| VMPL | AMD VM Permission Levels supported | +| VMSA_REGPROT | AMD VMSA Register Protection supported | +| VMX | Virtual Machine Extensions | +| VPCLMULQDQ | Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. | +| VTE | AMD Virtual Transparent Encryption supported | +| WAITPKG | TPAUSE, UMONITOR, UMWAIT | +| WBNOINVD | Write Back and Do Not Invalidate Cache | +| WRMSRNS | Non-Serializing Write to Model Specific Register | +| X87 | FPU | +| XGETBV1 | Supports XGETBV with ECX = 1 | +| XOP | Bulldozer XOP functions | +| XSAVE | XSAVE, XRESTOR, XSETBV, XGETBV | +| XSAVEC | Supports XSAVEC and the compacted form of XRSTOR. | +| XSAVEOPT | XSAVEOPT available | +| XSAVES | Supports XSAVES/XRSTORS and IA32_XSS | + +# ARM features: + +| Feature Flag | Description | +|--------------|------------------------------------------------------------------| +| AESARM | AES instructions | +| ARMCPUID | Some CPU ID registers readable at user-level | +| ASIMD | Advanced SIMD | +| ASIMDDP | SIMD Dot Product | +| ASIMDHP | Advanced SIMD half-precision floating point | +| ASIMDRDM | Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) | +| ATOMICS | Large System Extensions (LSE) | +| CRC32 | CRC32/CRC32C instructions | +| DCPOP | Data cache clean to Point of Persistence (DC CVAP) | +| EVTSTRM | Generic timer | +| FCMA | Floatin point complex number addition and multiplication | +| FP | Single-precision and double-precision floating point | +| FPHP | Half-precision floating point | +| GPA | Generic Pointer Authentication | +| JSCVT | Javascript-style double->int convert (FJCVTZS) | +| LRCPC | Weaker release consistency (LDAPR, etc) | +| PMULL | Polynomial Multiply instructions (PMULL/PMULL2) | +| SHA1 | SHA-1 instructions (SHA1C, etc) | +| SHA2 | SHA-2 instructions (SHA256H, etc) | +| SHA3 | SHA-3 instructions (EOR3, RAXI, XAR, BCAX) | +| SHA512 | SHA512 instructions | +| SM3 | SM3 instructions | +| SM4 | SM4 instructions | +| SVE | Scalable Vector Extension | + +# license + +This code is published under an MIT license. See LICENSE file for more information. diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go new file mode 100644 index 000000000..d015c744e --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -0,0 +1,1427 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +// Package cpuid provides information about the CPU running the current program. +// +// CPU features are detected on startup, and kept for fast access through the life of the application. +// Currently x86 / x64 (AMD64) as well as arm64 is supported. +// +// You can access the CPU information by accessing the shared CPU variable of the cpuid library. +// +// Package home: https://github.com/klauspost/cpuid +package cpuid + +import ( + "flag" + "fmt" + "math" + "math/bits" + "os" + "runtime" + "strings" +) + +// AMD refererence: https://www.amd.com/system/files/TechDocs/25481.pdf +// and Processor Programming Reference (PPR) + +// Vendor is a representation of a CPU vendor. +type Vendor int + +const ( + VendorUnknown Vendor = iota + Intel + AMD + VIA + Transmeta + NSC + KVM // Kernel-based Virtual Machine + MSVM // Microsoft Hyper-V or Windows Virtual PC + VMware + XenHVM + Bhyve + Hygon + SiS + RDC + + Ampere + ARM + Broadcom + Cavium + DEC + Fujitsu + Infineon + Motorola + NVIDIA + AMCC + Qualcomm + Marvell + + lastVendor +) + +//go:generate stringer -type=FeatureID,Vendor + +// FeatureID is the ID of a specific cpu feature. +type FeatureID int + +const ( + // Keep index -1 as unknown + UNKNOWN = -1 + + // Add features + ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions) + AESNI // Advanced Encryption Standard New Instructions + AMD3DNOW // AMD 3DNOW + AMD3DNOWEXT // AMD 3DNowExt + AMXBF16 // Tile computational operations on BFLOAT16 numbers + AMXFP16 // Tile computational operations on FP16 numbers + AMXINT8 // Tile computational operations on 8-bit integers + AMXTILE // Tile architecture + AVX // AVX functions + AVX2 // AVX2 functions + AVX512BF16 // AVX-512 BFLOAT16 Instructions + AVX512BITALG // AVX-512 Bit Algorithms + AVX512BW // AVX-512 Byte and Word Instructions + AVX512CD // AVX-512 Conflict Detection Instructions + AVX512DQ // AVX-512 Doubleword and Quadword Instructions + AVX512ER // AVX-512 Exponential and Reciprocal Instructions + AVX512F // AVX-512 Foundation + AVX512FP16 // AVX-512 FP16 Instructions + AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions + AVX512PF // AVX-512 Prefetch Instructions + AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions + AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2 + AVX512VL // AVX-512 Vector Length Extensions + AVX512VNNI // AVX-512 Vector Neural Network Instructions + AVX512VP2INTERSECT // AVX-512 Intersect for D/Q + AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword + AVXIFMA // AVX-IFMA instructions + AVXNECONVERT // AVX-NE-CONVERT instructions + AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one + AVXVNNI // AVX (VEX encoded) VNNI neural network instructions + AVXVNNIINT8 // AVX-VNNI-INT8 instructions + BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 + BMI1 // Bit Manipulation Instruction Set 1 + BMI2 // Bit Manipulation Instruction Set 2 + CETIBT // Intel CET Indirect Branch Tracking + CETSS // Intel CET Shadow Stack + CLDEMOTE // Cache Line Demote + CLMUL // Carry-less Multiplication + CLZERO // CLZERO instruction supported + CMOV // i686 CMOV + CMPCCXADD // CMPCCXADD instructions + CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB + CMPXCHG8 // CMPXCHG8 instruction + CPBOOST // Core Performance Boost + CPPC // AMD: Collaborative Processor Performance Control + CX16 // CMPXCHG16B Instruction + EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ + ENQCMD // Enqueue Command + ERMS // Enhanced REP MOVSB/STOSB + F16C // Half-precision floating-point conversion + FLUSH_L1D // Flush L1D cache + FMA3 // Intel FMA 3. Does not imply AVX. + FMA4 // Bulldozer FMA4 functions + FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide + FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide + FSRM // Fast Short Rep Mov + FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 + FXSROPT // FXSAVE/FXRSTOR optimizations + GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. + HLE // Hardware Lock Elision + HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR + HTT // Hyperthreading (enabled) + HWA // Hardware assert supported. Indicates support for MSRC001_10 + HYBRID_CPU // This part has CPUs of more than one type. + HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors + IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) + IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR + IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) + IBRS // AMD: Indirect Branch Restricted Speculation + IBRS_PREFERRED // AMD: IBRS is preferred over software solution + IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection + IBS // Instruction Based Sampling (AMD) + IBSBRNTRGT // Instruction Based Sampling Feature (AMD) + IBSFETCHSAM // Instruction Based Sampling Feature (AMD) + IBSFFV // Instruction Based Sampling Feature (AMD) + IBSOPCNT // Instruction Based Sampling Feature (AMD) + IBSOPCNTEXT // Instruction Based Sampling Feature (AMD) + IBSOPSAM // Instruction Based Sampling Feature (AMD) + IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) + IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) + IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported + IBS_OPDATA4 // AMD: IBS op data 4 MSR supported + IBS_OPFUSE // AMD: Indicates support for IbsOpFuse + IBS_PREVENTHOST // Disallowing IBS use by the host supported + IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4 + IDPRED_CTRL // IPRED_DIS + INT_WBINVD // WBINVD/WBNOINVD are interruptible. + INVLPGB // NVLPGB and TLBSYNC instruction supported + LAHF // LAHF/SAHF in long mode + LAM // If set, CPU supports Linear Address Masking + LBRVIRT // LBR virtualization + LZCNT // LZCNT instruction + MCAOVERFLOW // MCA overflow recovery support. + MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. + MCOMMIT // MCOMMIT instruction supported + MD_CLEAR // VERW clears CPU buffers + MMX // standard MMX + MMXEXT // SSE integer functions or AMD MMX ext + MOVBE // MOVBE instruction (big-endian) + MOVDIR64B // Move 64 Bytes as Direct Store + MOVDIRI // Move Doubleword as Direct Store + MOVSB_ZL // Fast Zero-Length MOVSB + MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD + MPX // Intel MPX (Memory Protection Extensions) + MSRIRC // Instruction Retired Counter MSR available + MSRLIST // Read/Write List of Model Specific Registers + MSR_PAGEFLUSH // Page Flush MSR available + NRIPS // Indicates support for NRIP save on VMEXIT + NX // NX (No-Execute) bit + OSXSAVE // XSAVE enabled by OS + PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption + POPCNT // POPCNT instruction + PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled + PREFETCHI // PREFETCHIT0/1 instructions + PSFD // Predictive Store Forward Disable + RDPRU // RDPRU instruction supported + RDRAND // RDRAND instruction is available + RDSEED // RDSEED instruction is available + RDTSCP // RDTSCP Instruction + RRSBA_CTRL // Restricted RSB Alternate + RTM // Restricted Transactional Memory + RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. + SERIALIZE // Serialize Instruction Execution + SEV // AMD Secure Encrypted Virtualization supported + SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host + SEV_ALTERNATIVE // AMD SEV Alternate Injection supported + SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests + SEV_ES // AMD SEV Encrypted State supported + SEV_RESTRICTED // AMD SEV Restricted Injection supported + SEV_SNP // AMD SEV Secure Nested Paging supported + SGX // Software Guard Extensions + SGXLC // Software Guard Extensions Launch Control + SHA // Intel SHA Extensions + SME // AMD Secure Memory Encryption supported + SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced + SPEC_CTRL_SSBD // Speculative Store Bypass Disable + SRBDS_CTRL // SRBDS mitigation MSR available + SSE // SSE functions + SSE2 // P4 SSE functions + SSE3 // Prescott SSE3 functions + SSE4 // Penryn SSE4.1 functions + SSE42 // Nehalem SSE4.2 functions + SSE4A // AMD Barcelona microarchitecture SSE4a instructions + SSSE3 // Conroe SSSE3 functions + STIBP // Single Thread Indirect Branch Predictors + STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On + STOSB_SHORT // Fast short STOSB + SUCCOR // Software uncorrectable error containment and recovery capability. + SVM // AMD Secure Virtual Machine + SVMDA // Indicates support for the SVM decode assists. + SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control + SVML // AMD SVM lock. Indicates support for SVM-Lock. + SVMNP // AMD SVM nested paging + SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter + SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold + SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. + SYSEE // SYSENTER and SYSEXIT instructions + TBM // AMD Trailing Bit Manipulation + TDX_GUEST // Intel Trust Domain Extensions Guest + TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations + TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. + TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. + TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 + TSXLDTRK // Intel TSX Suspend Load Address Tracking + VAES // Vector AES. AVX(512) versions requires additional checks. + VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. + VMPL // AMD VM Permission Levels supported + VMSA_REGPROT // AMD VMSA Register Protection supported + VMX // Virtual Machine Extensions + VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. + VTE // AMD Virtual Transparent Encryption supported + WAITPKG // TPAUSE, UMONITOR, UMWAIT + WBNOINVD // Write Back and Do Not Invalidate Cache + WRMSRNS // Non-Serializing Write to Model Specific Register + X87 // FPU + XGETBV1 // Supports XGETBV with ECX = 1 + XOP // Bulldozer XOP functions + XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV + XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. + XSAVEOPT // XSAVEOPT available + XSAVES // Supports XSAVES/XRSTORS and IA32_XSS + + // ARM features: + AESARM // AES instructions + ARMCPUID // Some CPU ID registers readable at user-level + ASIMD // Advanced SIMD + ASIMDDP // SIMD Dot Product + ASIMDHP // Advanced SIMD half-precision floating point + ASIMDRDM // Rounding Double Multiply Accumulate/Subtract (SQRDMLAH/SQRDMLSH) + ATOMICS // Large System Extensions (LSE) + CRC32 // CRC32/CRC32C instructions + DCPOP // Data cache clean to Point of Persistence (DC CVAP) + EVTSTRM // Generic timer + FCMA // Floatin point complex number addition and multiplication + FP // Single-precision and double-precision floating point + FPHP // Half-precision floating point + GPA // Generic Pointer Authentication + JSCVT // Javascript-style double->int convert (FJCVTZS) + LRCPC // Weaker release consistency (LDAPR, etc) + PMULL // Polynomial Multiply instructions (PMULL/PMULL2) + SHA1 // SHA-1 instructions (SHA1C, etc) + SHA2 // SHA-2 instructions (SHA256H, etc) + SHA3 // SHA-3 instructions (EOR3, RAXI, XAR, BCAX) + SHA512 // SHA512 instructions + SM3 // SM3 instructions + SM4 // SM4 instructions + SVE // Scalable Vector Extension + // Keep it last. It automatically defines the size of []flagSet + lastID + + firstID FeatureID = UNKNOWN + 1 +) + +// CPUInfo contains information about the detected system CPU. +type CPUInfo struct { + BrandName string // Brand name reported by the CPU + VendorID Vendor // Comparable CPU vendor ID + VendorString string // Raw vendor string. + featureSet flagSet // Features of the CPU + PhysicalCores int // Number of physical processor cores in your CPU. Will be 0 if undetectable. + ThreadsPerCore int // Number of threads per physical core. Will be 1 if undetectable. + LogicalCores int // Number of physical cores times threads that can run on each core through the use of hyperthreading. Will be 0 if undetectable. + Family int // CPU family number + Model int // CPU model number + Stepping int // CPU stepping info + CacheLine int // Cache line size in bytes. Will be 0 if undetectable. + Hz int64 // Clock speed, if known, 0 otherwise. Will attempt to contain base clock speed. + BoostFreq int64 // Max clock speed, if known, 0 otherwise + Cache struct { + L1I int // L1 Instruction Cache (per core or shared). Will be -1 if undetected + L1D int // L1 Data Cache (per core or shared). Will be -1 if undetected + L2 int // L2 Cache (per core or shared). Will be -1 if undetected + L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected + } + SGX SGXSupport + maxFunc uint32 + maxExFunc uint32 +} + +var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) +var cpuidex func(op, op2 uint32) (eax, ebx, ecx, edx uint32) +var xgetbv func(index uint32) (eax, edx uint32) +var rdtscpAsm func() (eax, ebx, ecx, edx uint32) +var darwinHasAVX512 = func() bool { return false } + +// CPU contains information about the CPU as detected on startup, +// or when Detect last was called. +// +// Use this as the primary entry point to you data. +var CPU CPUInfo + +func init() { + initCPU() + Detect() +} + +// Detect will re-detect current CPU info. +// This will replace the content of the exported CPU variable. +// +// Unless you expect the CPU to change while you are running your program +// you should not need to call this function. +// If you call this, you must ensure that no other goroutine is accessing the +// exported CPU variable. +func Detect() { + // Set defaults + CPU.ThreadsPerCore = 1 + CPU.Cache.L1I = -1 + CPU.Cache.L1D = -1 + CPU.Cache.L2 = -1 + CPU.Cache.L3 = -1 + safe := true + if detectArmFlag != nil { + safe = !*detectArmFlag + } + addInfo(&CPU, safe) + if displayFeats != nil && *displayFeats { + fmt.Println("cpu features:", strings.Join(CPU.FeatureSet(), ",")) + // Exit with non-zero so tests will print value. + os.Exit(1) + } + if disableFlag != nil { + s := strings.Split(*disableFlag, ",") + for _, feat := range s { + feat := ParseFeature(strings.TrimSpace(feat)) + if feat != UNKNOWN { + CPU.featureSet.unset(feat) + } + } + } +} + +// DetectARM will detect ARM64 features. +// This is NOT done automatically since it can potentially crash +// if the OS does not handle the command. +// If in the future this can be done safely this function may not +// do anything. +func DetectARM() { + addInfo(&CPU, false) +} + +var detectArmFlag *bool +var displayFeats *bool +var disableFlag *string + +// Flags will enable flags. +// This must be called *before* flag.Parse AND +// Detect must be called after the flags have been parsed. +// Note that this means that any detection used in init() functions +// will not contain these flags. +func Flags() { + disableFlag = flag.String("cpu.disable", "", "disable cpu features; comma separated list") + displayFeats = flag.Bool("cpu.features", false, "lists cpu features and exits") + detectArmFlag = flag.Bool("cpu.arm", false, "allow ARM features to be detected; can potentially crash") +} + +// Supports returns whether the CPU supports all of the requested features. +func (c CPUInfo) Supports(ids ...FeatureID) bool { + for _, id := range ids { + if !c.featureSet.inSet(id) { + return false + } + } + return true +} + +// Has allows for checking a single feature. +// Should be inlined by the compiler. +func (c *CPUInfo) Has(id FeatureID) bool { + return c.featureSet.inSet(id) +} + +// AnyOf returns whether the CPU supports one or more of the requested features. +func (c CPUInfo) AnyOf(ids ...FeatureID) bool { + for _, id := range ids { + if c.featureSet.inSet(id) { + return true + } + } + return false +} + +// Features contains several features combined for a fast check using +// CpuInfo.HasAll +type Features *flagSet + +// CombineFeatures allows to combine several features for a close to constant time lookup. +func CombineFeatures(ids ...FeatureID) Features { + var v flagSet + for _, id := range ids { + v.set(id) + } + return &v +} + +func (c *CPUInfo) HasAll(f Features) bool { + return c.featureSet.hasSetP(f) +} + +// https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels +var oneOfLevel = CombineFeatures(SYSEE, SYSCALL) +var level1Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2) +var level2Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3) +var level3Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE) +var level4Features = CombineFeatures(CMOV, CMPXCHG8, X87, FXSR, MMX, SSE, SSE2, CX16, LAHF, POPCNT, SSE3, SSE4, SSE42, SSSE3, AVX, AVX2, BMI1, BMI2, F16C, FMA3, LZCNT, MOVBE, OSXSAVE, AVX512F, AVX512BW, AVX512CD, AVX512DQ, AVX512VL) + +// X64Level returns the microarchitecture level detected on the CPU. +// If features are lacking or non x64 mode, 0 is returned. +// See https://en.wikipedia.org/wiki/X86-64#Microarchitecture_levels +func (c CPUInfo) X64Level() int { + if !c.featureSet.hasOneOf(oneOfLevel) { + return 0 + } + if c.featureSet.hasSetP(level4Features) { + return 4 + } + if c.featureSet.hasSetP(level3Features) { + return 3 + } + if c.featureSet.hasSetP(level2Features) { + return 2 + } + if c.featureSet.hasSetP(level1Features) { + return 1 + } + return 0 +} + +// Disable will disable one or several features. +func (c *CPUInfo) Disable(ids ...FeatureID) bool { + for _, id := range ids { + c.featureSet.unset(id) + } + return true +} + +// Enable will disable one or several features even if they were undetected. +// This is of course not recommended for obvious reasons. +func (c *CPUInfo) Enable(ids ...FeatureID) bool { + for _, id := range ids { + c.featureSet.set(id) + } + return true +} + +// IsVendor returns true if vendor is recognized as Intel +func (c CPUInfo) IsVendor(v Vendor) bool { + return c.VendorID == v +} + +// FeatureSet returns all available features as strings. +func (c CPUInfo) FeatureSet() []string { + s := make([]string, 0, c.featureSet.nEnabled()) + s = append(s, c.featureSet.Strings()...) + return s +} + +// RTCounter returns the 64-bit time-stamp counter +// Uses the RDTSCP instruction. The value 0 is returned +// if the CPU does not support the instruction. +func (c CPUInfo) RTCounter() uint64 { + if !c.Supports(RDTSCP) { + return 0 + } + a, _, _, d := rdtscpAsm() + return uint64(a) | (uint64(d) << 32) +} + +// Ia32TscAux returns the IA32_TSC_AUX part of the RDTSCP. +// This variable is OS dependent, but on Linux contains information +// about the current cpu/core the code is running on. +// If the RDTSCP instruction isn't supported on the CPU, the value 0 is returned. +func (c CPUInfo) Ia32TscAux() uint32 { + if !c.Supports(RDTSCP) { + return 0 + } + _, _, ecx, _ := rdtscpAsm() + return ecx +} + +// LogicalCPU will return the Logical CPU the code is currently executing on. +// This is likely to change when the OS re-schedules the running thread +// to another CPU. +// If the current core cannot be detected, -1 will be returned. +func (c CPUInfo) LogicalCPU() int { + if c.maxFunc < 1 { + return -1 + } + _, ebx, _, _ := cpuid(1) + return int(ebx >> 24) +} + +// frequencies tries to compute the clock speed of the CPU. If leaf 15 is +// supported, use it, otherwise parse the brand string. Yes, really. +func (c *CPUInfo) frequencies() { + c.Hz, c.BoostFreq = 0, 0 + mfi := maxFunctionID() + if mfi >= 0x15 { + eax, ebx, ecx, _ := cpuid(0x15) + if eax != 0 && ebx != 0 && ecx != 0 { + c.Hz = (int64(ecx) * int64(ebx)) / int64(eax) + } + } + if mfi >= 0x16 { + a, b, _, _ := cpuid(0x16) + // Base... + if a&0xffff > 0 { + c.Hz = int64(a&0xffff) * 1_000_000 + } + // Boost... + if b&0xffff > 0 { + c.BoostFreq = int64(b&0xffff) * 1_000_000 + } + } + if c.Hz > 0 { + return + } + + // computeHz determines the official rated speed of a CPU from its brand + // string. This insanity is *actually the official documented way to do + // this according to Intel*, prior to leaf 0x15 existing. The official + // documentation only shows this working for exactly `x.xx` or `xxxx` + // cases, e.g., `2.50GHz` or `1300MHz`; this parser will accept other + // sizes. + model := c.BrandName + hz := strings.LastIndex(model, "Hz") + if hz < 3 { + return + } + var multiplier int64 + switch model[hz-1] { + case 'M': + multiplier = 1000 * 1000 + case 'G': + multiplier = 1000 * 1000 * 1000 + case 'T': + multiplier = 1000 * 1000 * 1000 * 1000 + } + if multiplier == 0 { + return + } + freq := int64(0) + divisor := int64(0) + decimalShift := int64(1) + var i int + for i = hz - 2; i >= 0 && model[i] != ' '; i-- { + if model[i] >= '0' && model[i] <= '9' { + freq += int64(model[i]-'0') * decimalShift + decimalShift *= 10 + } else if model[i] == '.' { + if divisor != 0 { + return + } + divisor = decimalShift + } else { + return + } + } + // we didn't find a space + if i < 0 { + return + } + if divisor != 0 { + c.Hz = (freq * multiplier) / divisor + return + } + c.Hz = freq * multiplier +} + +// VM Will return true if the cpu id indicates we are in +// a virtual machine. +func (c CPUInfo) VM() bool { + return CPU.featureSet.inSet(HYPERVISOR) +} + +// flags contains detected cpu features and characteristics +type flags uint64 + +// log2(bits_in_uint64) +const flagBitsLog2 = 6 +const flagBits = 1 << flagBitsLog2 +const flagMask = flagBits - 1 + +// flagSet contains detected cpu features and characteristics in an array of flags +type flagSet [(lastID + flagMask) / flagBits]flags + +func (s *flagSet) inSet(feat FeatureID) bool { + return s[feat>>flagBitsLog2]&(1<<(feat&flagMask)) != 0 +} + +func (s *flagSet) set(feat FeatureID) { + s[feat>>flagBitsLog2] |= 1 << (feat & flagMask) +} + +// setIf will set a feature if boolean is true. +func (s *flagSet) setIf(cond bool, features ...FeatureID) { + if cond { + for _, offset := range features { + s[offset>>flagBitsLog2] |= 1 << (offset & flagMask) + } + } +} + +func (s *flagSet) unset(offset FeatureID) { + bit := flags(1 << (offset & flagMask)) + s[offset>>flagBitsLog2] = s[offset>>flagBitsLog2] & ^bit +} + +// or with another flagset. +func (s *flagSet) or(other flagSet) { + for i, v := range other[:] { + s[i] |= v + } +} + +// hasSet returns whether all features are present. +func (s *flagSet) hasSet(other flagSet) bool { + for i, v := range other[:] { + if s[i]&v != v { + return false + } + } + return true +} + +// hasSet returns whether all features are present. +func (s *flagSet) hasSetP(other *flagSet) bool { + for i, v := range other[:] { + if s[i]&v != v { + return false + } + } + return true +} + +// hasOneOf returns whether one or more features are present. +func (s *flagSet) hasOneOf(other *flagSet) bool { + for i, v := range other[:] { + if s[i]&v != 0 { + return true + } + } + return false +} + +// nEnabled will return the number of enabled flags. +func (s *flagSet) nEnabled() (n int) { + for _, v := range s[:] { + n += bits.OnesCount64(uint64(v)) + } + return n +} + +func flagSetWith(feat ...FeatureID) flagSet { + var res flagSet + for _, f := range feat { + res.set(f) + } + return res +} + +// ParseFeature will parse the string and return the ID of the matching feature. +// Will return UNKNOWN if not found. +func ParseFeature(s string) FeatureID { + s = strings.ToUpper(s) + for i := firstID; i < lastID; i++ { + if i.String() == s { + return i + } + } + return UNKNOWN +} + +// Strings returns an array of the detected features for FlagsSet. +func (s flagSet) Strings() []string { + if len(s) == 0 { + return []string{""} + } + r := make([]string, 0) + for i := firstID; i < lastID; i++ { + if s.inSet(i) { + r = append(r, i.String()) + } + } + return r +} + +func maxExtendedFunction() uint32 { + eax, _, _, _ := cpuid(0x80000000) + return eax +} + +func maxFunctionID() uint32 { + a, _, _, _ := cpuid(0) + return a +} + +func brandName() string { + if maxExtendedFunction() >= 0x80000004 { + v := make([]uint32, 0, 48) + for i := uint32(0); i < 3; i++ { + a, b, c, d := cpuid(0x80000002 + i) + v = append(v, a, b, c, d) + } + return strings.Trim(string(valAsString(v...)), " ") + } + return "unknown" +} + +func threadsPerCore() int { + mfi := maxFunctionID() + vend, _ := vendorID() + + if mfi < 0x4 || (vend != Intel && vend != AMD) { + return 1 + } + + if mfi < 0xb { + if vend != Intel { + return 1 + } + _, b, _, d := cpuid(1) + if (d & (1 << 28)) != 0 { + // v will contain logical core count + v := (b >> 16) & 255 + if v > 1 { + a4, _, _, _ := cpuid(4) + // physical cores + v2 := (a4 >> 26) + 1 + if v2 > 0 { + return int(v) / int(v2) + } + } + } + return 1 + } + _, b, _, _ := cpuidex(0xb, 0) + if b&0xffff == 0 { + if vend == AMD { + // Workaround for AMD returning 0, assume 2 if >= Zen 2 + // It will be more correct than not. + fam, _, _ := familyModel() + _, _, _, d := cpuid(1) + if (d&(1<<28)) != 0 && fam >= 23 { + return 2 + } + } + return 1 + } + return int(b & 0xffff) +} + +func logicalCores() int { + mfi := maxFunctionID() + v, _ := vendorID() + switch v { + case Intel: + // Use this on old Intel processors + if mfi < 0xb { + if mfi < 1 { + return 0 + } + // CPUID.1:EBX[23:16] represents the maximum number of addressable IDs (initial APIC ID) + // that can be assigned to logical processors in a physical package. + // The value may not be the same as the number of logical processors that are present in the hardware of a physical package. + _, ebx, _, _ := cpuid(1) + logical := (ebx >> 16) & 0xff + return int(logical) + } + _, b, _, _ := cpuidex(0xb, 1) + return int(b & 0xffff) + case AMD, Hygon: + _, b, _, _ := cpuid(1) + return int((b >> 16) & 0xff) + default: + return 0 + } +} + +func familyModel() (family, model, stepping int) { + if maxFunctionID() < 0x1 { + return 0, 0, 0 + } + eax, _, _, _ := cpuid(1) + // If BaseFamily[3:0] is less than Fh then ExtendedFamily[7:0] is reserved and Family is equal to BaseFamily[3:0]. + family = int((eax >> 8) & 0xf) + extFam := family == 0x6 // Intel is 0x6, needs extended model. + if family == 0xf { + // Add ExtFamily + family += int((eax >> 20) & 0xff) + extFam = true + } + // If BaseFamily[3:0] is less than 0Fh then ExtendedModel[3:0] is reserved and Model is equal to BaseModel[3:0]. + model = int((eax >> 4) & 0xf) + if extFam { + // Add ExtModel + model += int((eax >> 12) & 0xf0) + } + stepping = int(eax & 0xf) + return family, model, stepping +} + +func physicalCores() int { + v, _ := vendorID() + switch v { + case Intel: + return logicalCores() / threadsPerCore() + case AMD, Hygon: + lc := logicalCores() + tpc := threadsPerCore() + if lc > 0 && tpc > 0 { + return lc / tpc + } + + // The following is inaccurate on AMD EPYC 7742 64-Core Processor + if maxExtendedFunction() >= 0x80000008 { + _, _, c, _ := cpuid(0x80000008) + if c&0xff > 0 { + return int(c&0xff) + 1 + } + } + } + return 0 +} + +// Except from http://en.wikipedia.org/wiki/CPUID#EAX.3D0:_Get_vendor_ID +var vendorMapping = map[string]Vendor{ + "AMDisbetter!": AMD, + "AuthenticAMD": AMD, + "CentaurHauls": VIA, + "GenuineIntel": Intel, + "TransmetaCPU": Transmeta, + "GenuineTMx86": Transmeta, + "Geode by NSC": NSC, + "VIA VIA VIA ": VIA, + "KVMKVMKVMKVM": KVM, + "Microsoft Hv": MSVM, + "VMwareVMware": VMware, + "XenVMMXenVMM": XenHVM, + "bhyve bhyve ": Bhyve, + "HygonGenuine": Hygon, + "Vortex86 SoC": SiS, + "SiS SiS SiS ": SiS, + "RiseRiseRise": SiS, + "Genuine RDC": RDC, +} + +func vendorID() (Vendor, string) { + _, b, c, d := cpuid(0) + v := string(valAsString(b, d, c)) + vend, ok := vendorMapping[v] + if !ok { + return VendorUnknown, v + } + return vend, v +} + +func cacheLine() int { + if maxFunctionID() < 0x1 { + return 0 + } + + _, ebx, _, _ := cpuid(1) + cache := (ebx & 0xff00) >> 5 // cflush size + if cache == 0 && maxExtendedFunction() >= 0x80000006 { + _, _, ecx, _ := cpuid(0x80000006) + cache = ecx & 0xff // cacheline size + } + // TODO: Read from Cache and TLB Information + return int(cache) +} + +func (c *CPUInfo) cacheSize() { + c.Cache.L1D = -1 + c.Cache.L1I = -1 + c.Cache.L2 = -1 + c.Cache.L3 = -1 + vendor, _ := vendorID() + switch vendor { + case Intel: + if maxFunctionID() < 4 { + return + } + c.Cache.L1I, c.Cache.L1D, c.Cache.L2, c.Cache.L3 = 0, 0, 0, 0 + for i := uint32(0); ; i++ { + eax, ebx, ecx, _ := cpuidex(4, i) + cacheType := eax & 15 + if cacheType == 0 { + break + } + cacheLevel := (eax >> 5) & 7 + coherency := int(ebx&0xfff) + 1 + partitions := int((ebx>>12)&0x3ff) + 1 + associativity := int((ebx>>22)&0x3ff) + 1 + sets := int(ecx) + 1 + size := associativity * partitions * coherency * sets + switch cacheLevel { + case 1: + if cacheType == 1 { + // 1 = Data Cache + c.Cache.L1D = size + } else if cacheType == 2 { + // 2 = Instruction Cache + c.Cache.L1I = size + } else { + if c.Cache.L1D < 0 { + c.Cache.L1I = size + } + if c.Cache.L1I < 0 { + c.Cache.L1I = size + } + } + case 2: + c.Cache.L2 = size + case 3: + c.Cache.L3 = size + } + } + case AMD, Hygon: + // Untested. + if maxExtendedFunction() < 0x80000005 { + return + } + _, _, ecx, edx := cpuid(0x80000005) + c.Cache.L1D = int(((ecx >> 24) & 0xFF) * 1024) + c.Cache.L1I = int(((edx >> 24) & 0xFF) * 1024) + + if maxExtendedFunction() < 0x80000006 { + return + } + _, _, ecx, _ = cpuid(0x80000006) + c.Cache.L2 = int(((ecx >> 16) & 0xFFFF) * 1024) + + // CPUID Fn8000_001D_EAX_x[N:0] Cache Properties + if maxExtendedFunction() < 0x8000001D || !c.Has(TOPEXT) { + return + } + + // Xen Hypervisor is buggy and returns the same entry no matter ECX value. + // Hack: When we encounter the same entry 100 times we break. + nSame := 0 + var last uint32 + for i := uint32(0); i < math.MaxUint32; i++ { + eax, ebx, ecx, _ := cpuidex(0x8000001D, i) + + level := (eax >> 5) & 7 + cacheNumSets := ecx + 1 + cacheLineSize := 1 + (ebx & 2047) + cachePhysPartitions := 1 + ((ebx >> 12) & 511) + cacheNumWays := 1 + ((ebx >> 22) & 511) + + typ := eax & 15 + size := int(cacheNumSets * cacheLineSize * cachePhysPartitions * cacheNumWays) + if typ == 0 { + return + } + + // Check for the same value repeated. + comb := eax ^ ebx ^ ecx + if comb == last { + nSame++ + if nSame == 100 { + return + } + } + last = comb + + switch level { + case 1: + switch typ { + case 1: + // Data cache + c.Cache.L1D = size + case 2: + // Inst cache + c.Cache.L1I = size + default: + if c.Cache.L1D < 0 { + c.Cache.L1I = size + } + if c.Cache.L1I < 0 { + c.Cache.L1I = size + } + } + case 2: + c.Cache.L2 = size + case 3: + c.Cache.L3 = size + } + } + } +} + +type SGXEPCSection struct { + BaseAddress uint64 + EPCSize uint64 +} + +type SGXSupport struct { + Available bool + LaunchControl bool + SGX1Supported bool + SGX2Supported bool + MaxEnclaveSizeNot64 int64 + MaxEnclaveSize64 int64 + EPCSections []SGXEPCSection +} + +func hasSGX(available, lc bool) (rval SGXSupport) { + rval.Available = available + + if !available { + return + } + + rval.LaunchControl = lc + + a, _, _, d := cpuidex(0x12, 0) + rval.SGX1Supported = a&0x01 != 0 + rval.SGX2Supported = a&0x02 != 0 + rval.MaxEnclaveSizeNot64 = 1 << (d & 0xFF) // pow 2 + rval.MaxEnclaveSize64 = 1 << ((d >> 8) & 0xFF) // pow 2 + rval.EPCSections = make([]SGXEPCSection, 0) + + for subleaf := uint32(2); subleaf < 2+8; subleaf++ { + eax, ebx, ecx, edx := cpuidex(0x12, subleaf) + leafType := eax & 0xf + + if leafType == 0 { + // Invalid subleaf, stop iterating + break + } else if leafType == 1 { + // EPC Section subleaf + baseAddress := uint64(eax&0xfffff000) + (uint64(ebx&0x000fffff) << 32) + size := uint64(ecx&0xfffff000) + (uint64(edx&0x000fffff) << 32) + + section := SGXEPCSection{BaseAddress: baseAddress, EPCSize: size} + rval.EPCSections = append(rval.EPCSections, section) + } + } + + return +} + +func support() flagSet { + var fs flagSet + mfi := maxFunctionID() + vend, _ := vendorID() + if mfi < 0x1 { + return fs + } + family, model, _ := familyModel() + + _, _, c, d := cpuid(1) + fs.setIf((d&(1<<0)) != 0, X87) + fs.setIf((d&(1<<8)) != 0, CMPXCHG8) + fs.setIf((d&(1<<11)) != 0, SYSEE) + fs.setIf((d&(1<<15)) != 0, CMOV) + fs.setIf((d&(1<<23)) != 0, MMX) + fs.setIf((d&(1<<24)) != 0, FXSR) + fs.setIf((d&(1<<25)) != 0, FXSROPT) + fs.setIf((d&(1<<25)) != 0, SSE) + fs.setIf((d&(1<<26)) != 0, SSE2) + fs.setIf((c&1) != 0, SSE3) + fs.setIf((c&(1<<5)) != 0, VMX) + fs.setIf((c&(1<<9)) != 0, SSSE3) + fs.setIf((c&(1<<19)) != 0, SSE4) + fs.setIf((c&(1<<20)) != 0, SSE42) + fs.setIf((c&(1<<25)) != 0, AESNI) + fs.setIf((c&(1<<1)) != 0, CLMUL) + fs.setIf(c&(1<<22) != 0, MOVBE) + fs.setIf(c&(1<<23) != 0, POPCNT) + fs.setIf(c&(1<<30) != 0, RDRAND) + + // This bit has been reserved by Intel & AMD for use by hypervisors, + // and indicates the presence of a hypervisor. + fs.setIf(c&(1<<31) != 0, HYPERVISOR) + fs.setIf(c&(1<<29) != 0, F16C) + fs.setIf(c&(1<<13) != 0, CX16) + + if vend == Intel && (d&(1<<28)) != 0 && mfi >= 4 { + fs.setIf(threadsPerCore() > 1, HTT) + } + if vend == AMD && (d&(1<<28)) != 0 && mfi >= 4 { + fs.setIf(threadsPerCore() > 1, HTT) + } + fs.setIf(c&1<<26 != 0, XSAVE) + fs.setIf(c&1<<27 != 0, OSXSAVE) + // Check XGETBV/XSAVE (26), OXSAVE (27) and AVX (28) bits + const avxCheck = 1<<26 | 1<<27 | 1<<28 + if c&avxCheck == avxCheck { + // Check for OS support + eax, _ := xgetbv(0) + if (eax & 0x6) == 0x6 { + fs.set(AVX) + switch vend { + case Intel: + // Older than Haswell. + fs.setIf(family == 6 && model < 60, AVXSLOW) + case AMD: + // Older than Zen 2 + fs.setIf(family < 23 || (family == 23 && model < 49), AVXSLOW) + } + } + } + // FMA3 can be used with SSE registers, so no OS support is strictly needed. + // fma3 and OSXSAVE needed. + const fma3Check = 1<<12 | 1<<27 + fs.setIf(c&fma3Check == fma3Check, FMA3) + + // Check AVX2, AVX2 requires OS support, but BMI1/2 don't. + if mfi >= 7 { + _, ebx, ecx, edx := cpuidex(7, 0) + if fs.inSet(AVX) && (ebx&0x00000020) != 0 { + fs.set(AVX2) + } + // CPUID.(EAX=7, ECX=0).EBX + if (ebx & 0x00000008) != 0 { + fs.set(BMI1) + fs.setIf((ebx&0x00000100) != 0, BMI2) + } + fs.setIf(ebx&(1<<2) != 0, SGX) + fs.setIf(ebx&(1<<4) != 0, HLE) + fs.setIf(ebx&(1<<9) != 0, ERMS) + fs.setIf(ebx&(1<<11) != 0, RTM) + fs.setIf(ebx&(1<<14) != 0, MPX) + fs.setIf(ebx&(1<<18) != 0, RDSEED) + fs.setIf(ebx&(1<<19) != 0, ADX) + fs.setIf(ebx&(1<<29) != 0, SHA) + + // CPUID.(EAX=7, ECX=0).ECX + fs.setIf(ecx&(1<<5) != 0, WAITPKG) + fs.setIf(ecx&(1<<7) != 0, CETSS) + fs.setIf(ecx&(1<<8) != 0, GFNI) + fs.setIf(ecx&(1<<9) != 0, VAES) + fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) + fs.setIf(ecx&(1<<13) != 0, TME) + fs.setIf(ecx&(1<<25) != 0, CLDEMOTE) + fs.setIf(ecx&(1<<27) != 0, MOVDIRI) + fs.setIf(ecx&(1<<28) != 0, MOVDIR64B) + fs.setIf(ecx&(1<<29) != 0, ENQCMD) + fs.setIf(ecx&(1<<30) != 0, SGXLC) + + // CPUID.(EAX=7, ECX=0).EDX + fs.setIf(edx&(1<<4) != 0, FSRM) + fs.setIf(edx&(1<<9) != 0, SRBDS_CTRL) + fs.setIf(edx&(1<<10) != 0, MD_CLEAR) + fs.setIf(edx&(1<<11) != 0, RTM_ALWAYS_ABORT) + fs.setIf(edx&(1<<14) != 0, SERIALIZE) + fs.setIf(edx&(1<<15) != 0, HYBRID_CPU) + fs.setIf(edx&(1<<16) != 0, TSXLDTRK) + fs.setIf(edx&(1<<18) != 0, PCONFIG) + fs.setIf(edx&(1<<20) != 0, CETIBT) + fs.setIf(edx&(1<<26) != 0, IBPB) + fs.setIf(edx&(1<<27) != 0, STIBP) + fs.setIf(edx&(1<<28) != 0, FLUSH_L1D) + fs.setIf(edx&(1<<29) != 0, IA32_ARCH_CAP) + fs.setIf(edx&(1<<30) != 0, IA32_CORE_CAP) + fs.setIf(edx&(1<<31) != 0, SPEC_CTRL_SSBD) + + // CPUID.(EAX=7, ECX=1).EAX + eax1, _, _, edx1 := cpuidex(7, 1) + fs.setIf(fs.inSet(AVX) && eax1&(1<<4) != 0, AVXVNNI) + fs.setIf(eax1&(1<<7) != 0, CMPCCXADD) + fs.setIf(eax1&(1<<10) != 0, MOVSB_ZL) + fs.setIf(eax1&(1<<11) != 0, STOSB_SHORT) + fs.setIf(eax1&(1<<12) != 0, CMPSB_SCADBS_SHORT) + fs.setIf(eax1&(1<<22) != 0, HRESET) + fs.setIf(eax1&(1<<23) != 0, AVXIFMA) + fs.setIf(eax1&(1<<26) != 0, LAM) + + // CPUID.(EAX=7, ECX=1).EDX + fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8) + fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT) + fs.setIf(edx1&(1<<14) != 0, PREFETCHI) + + // Only detect AVX-512 features if XGETBV is supported + if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) { + // Check for OS support + eax, _ := xgetbv(0) + + // Verify that XCR0[7:5] = ‘111b’ (OPMASK state, upper 256-bit of ZMM0-ZMM15 and + // ZMM16-ZMM31 state are enabled by OS) + /// and that XCR0[2:1] = ‘11b’ (XMM state and YMM state are enabled by OS). + hasAVX512 := (eax>>5)&7 == 7 && (eax>>1)&3 == 3 + if runtime.GOOS == "darwin" { + hasAVX512 = fs.inSet(AVX) && darwinHasAVX512() + } + if hasAVX512 { + fs.setIf(ebx&(1<<16) != 0, AVX512F) + fs.setIf(ebx&(1<<17) != 0, AVX512DQ) + fs.setIf(ebx&(1<<21) != 0, AVX512IFMA) + fs.setIf(ebx&(1<<26) != 0, AVX512PF) + fs.setIf(ebx&(1<<27) != 0, AVX512ER) + fs.setIf(ebx&(1<<28) != 0, AVX512CD) + fs.setIf(ebx&(1<<30) != 0, AVX512BW) + fs.setIf(ebx&(1<<31) != 0, AVX512VL) + // ecx + fs.setIf(ecx&(1<<1) != 0, AVX512VBMI) + fs.setIf(ecx&(1<<6) != 0, AVX512VBMI2) + fs.setIf(ecx&(1<<11) != 0, AVX512VNNI) + fs.setIf(ecx&(1<<12) != 0, AVX512BITALG) + fs.setIf(ecx&(1<<14) != 0, AVX512VPOPCNTDQ) + // edx + fs.setIf(edx&(1<<8) != 0, AVX512VP2INTERSECT) + fs.setIf(edx&(1<<22) != 0, AMXBF16) + fs.setIf(edx&(1<<23) != 0, AVX512FP16) + fs.setIf(edx&(1<<24) != 0, AMXTILE) + fs.setIf(edx&(1<<25) != 0, AMXINT8) + // eax1 = CPUID.(EAX=7, ECX=1).EAX + fs.setIf(eax1&(1<<5) != 0, AVX512BF16) + fs.setIf(eax1&(1<<19) != 0, WRMSRNS) + fs.setIf(eax1&(1<<21) != 0, AMXFP16) + fs.setIf(eax1&(1<<27) != 0, MSRLIST) + } + } + + // CPUID.(EAX=7, ECX=2) + _, _, _, edx = cpuidex(7, 2) + fs.setIf(edx&(1<<0) != 0, PSFD) + fs.setIf(edx&(1<<1) != 0, IDPRED_CTRL) + fs.setIf(edx&(1<<2) != 0, RRSBA_CTRL) + fs.setIf(edx&(1<<4) != 0, BHI_CTRL) + fs.setIf(edx&(1<<5) != 0, MCDT_NO) + + } + + // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1) + // EAX + // Bit 00: XSAVEOPT is available. + // Bit 01: Supports XSAVEC and the compacted form of XRSTOR if set. + // Bit 02: Supports XGETBV with ECX = 1 if set. + // Bit 03: Supports XSAVES/XRSTORS and IA32_XSS if set. + // Bits 31 - 04: Reserved. + // EBX + // Bits 31 - 00: The size in bytes of the XSAVE area containing all states enabled by XCRO | IA32_XSS. + // ECX + // Bits 31 - 00: Reports the supported bits of the lower 32 bits of the IA32_XSS MSR. IA32_XSS[n] can be set to 1 only if ECX[n] is 1. + // EDX? + // Bits 07 - 00: Used for XCR0. Bit 08: PT state. Bit 09: Used for XCR0. Bits 12 - 10: Reserved. Bit 13: HWP state. Bits 31 - 14: Reserved. + if mfi >= 0xd { + if fs.inSet(XSAVE) { + eax, _, _, _ := cpuidex(0xd, 1) + fs.setIf(eax&(1<<0) != 0, XSAVEOPT) + fs.setIf(eax&(1<<1) != 0, XSAVEC) + fs.setIf(eax&(1<<2) != 0, XGETBV1) + fs.setIf(eax&(1<<3) != 0, XSAVES) + } + } + if maxExtendedFunction() >= 0x80000001 { + _, _, c, d := cpuid(0x80000001) + if (c & (1 << 5)) != 0 { + fs.set(LZCNT) + fs.set(POPCNT) + } + // ECX + fs.setIf((c&(1<<0)) != 0, LAHF) + fs.setIf((c&(1<<2)) != 0, SVM) + fs.setIf((c&(1<<6)) != 0, SSE4A) + fs.setIf((c&(1<<10)) != 0, IBS) + fs.setIf((c&(1<<22)) != 0, TOPEXT) + + // EDX + fs.setIf(d&(1<<11) != 0, SYSCALL) + fs.setIf(d&(1<<20) != 0, NX) + fs.setIf(d&(1<<22) != 0, MMXEXT) + fs.setIf(d&(1<<23) != 0, MMX) + fs.setIf(d&(1<<24) != 0, FXSR) + fs.setIf(d&(1<<25) != 0, FXSROPT) + fs.setIf(d&(1<<27) != 0, RDTSCP) + fs.setIf(d&(1<<30) != 0, AMD3DNOWEXT) + fs.setIf(d&(1<<31) != 0, AMD3DNOW) + + /* XOP and FMA4 use the AVX instruction coding scheme, so they can't be + * used unless the OS has AVX support. */ + if fs.inSet(AVX) { + fs.setIf((c&(1<<11)) != 0, XOP) + fs.setIf((c&(1<<16)) != 0, FMA4) + } + + } + if maxExtendedFunction() >= 0x80000007 { + _, b, _, d := cpuid(0x80000007) + fs.setIf((b&(1<<0)) != 0, MCAOVERFLOW) + fs.setIf((b&(1<<1)) != 0, SUCCOR) + fs.setIf((b&(1<<2)) != 0, HWA) + fs.setIf((d&(1<<9)) != 0, CPBOOST) + } + + if maxExtendedFunction() >= 0x80000008 { + _, b, _, _ := cpuid(0x80000008) + fs.setIf(b&(1<<28) != 0, PSFD) + fs.setIf(b&(1<<27) != 0, CPPC) + fs.setIf(b&(1<<24) != 0, SPEC_CTRL_SSBD) + fs.setIf(b&(1<<23) != 0, PPIN) + fs.setIf(b&(1<<21) != 0, TLB_FLUSH_NESTED) + fs.setIf(b&(1<<20) != 0, EFER_LMSLE_UNS) + fs.setIf(b&(1<<19) != 0, IBRS_PROVIDES_SMP) + fs.setIf(b&(1<<18) != 0, IBRS_PREFERRED) + fs.setIf(b&(1<<17) != 0, STIBP_ALWAYSON) + fs.setIf(b&(1<<15) != 0, STIBP) + fs.setIf(b&(1<<14) != 0, IBRS) + fs.setIf((b&(1<<13)) != 0, INT_WBINVD) + fs.setIf(b&(1<<12) != 0, IBPB) + fs.setIf((b&(1<<9)) != 0, WBNOINVD) + fs.setIf((b&(1<<8)) != 0, MCOMMIT) + fs.setIf((b&(1<<4)) != 0, RDPRU) + fs.setIf((b&(1<<3)) != 0, INVLPGB) + fs.setIf((b&(1<<1)) != 0, MSRIRC) + fs.setIf((b&(1<<0)) != 0, CLZERO) + } + + if fs.inSet(SVM) && maxExtendedFunction() >= 0x8000000A { + _, _, _, edx := cpuid(0x8000000A) + fs.setIf((edx>>0)&1 == 1, SVMNP) + fs.setIf((edx>>1)&1 == 1, LBRVIRT) + fs.setIf((edx>>2)&1 == 1, SVML) + fs.setIf((edx>>3)&1 == 1, NRIPS) + fs.setIf((edx>>4)&1 == 1, TSCRATEMSR) + fs.setIf((edx>>5)&1 == 1, VMCBCLEAN) + fs.setIf((edx>>6)&1 == 1, SVMFBASID) + fs.setIf((edx>>7)&1 == 1, SVMDA) + fs.setIf((edx>>10)&1 == 1, SVMPF) + fs.setIf((edx>>12)&1 == 1, SVMPFT) + } + + if maxExtendedFunction() >= 0x8000001a { + eax, _, _, _ := cpuid(0x8000001a) + fs.setIf((eax>>0)&1 == 1, FP128) + fs.setIf((eax>>1)&1 == 1, MOVU) + fs.setIf((eax>>2)&1 == 1, FP256) + } + + if maxExtendedFunction() >= 0x8000001b && fs.inSet(IBS) { + eax, _, _, _ := cpuid(0x8000001b) + fs.setIf((eax>>0)&1 == 1, IBSFFV) + fs.setIf((eax>>1)&1 == 1, IBSFETCHSAM) + fs.setIf((eax>>2)&1 == 1, IBSOPSAM) + fs.setIf((eax>>3)&1 == 1, IBSRDWROPCNT) + fs.setIf((eax>>4)&1 == 1, IBSOPCNT) + fs.setIf((eax>>5)&1 == 1, IBSBRNTRGT) + fs.setIf((eax>>6)&1 == 1, IBSOPCNTEXT) + fs.setIf((eax>>7)&1 == 1, IBSRIPINVALIDCHK) + fs.setIf((eax>>8)&1 == 1, IBS_OPFUSE) + fs.setIf((eax>>9)&1 == 1, IBS_FETCH_CTLX) + fs.setIf((eax>>10)&1 == 1, IBS_OPDATA4) // Doc says "Fixed,0. IBS op data 4 MSR supported", but assuming they mean 1. + fs.setIf((eax>>11)&1 == 1, IBS_ZEN4) + } + + if maxExtendedFunction() >= 0x8000001f && vend == AMD { + a, _, _, _ := cpuid(0x8000001f) + fs.setIf((a>>0)&1 == 1, SME) + fs.setIf((a>>1)&1 == 1, SEV) + fs.setIf((a>>2)&1 == 1, MSR_PAGEFLUSH) + fs.setIf((a>>3)&1 == 1, SEV_ES) + fs.setIf((a>>4)&1 == 1, SEV_SNP) + fs.setIf((a>>5)&1 == 1, VMPL) + fs.setIf((a>>10)&1 == 1, SME_COHERENT) + fs.setIf((a>>11)&1 == 1, SEV_64BIT) + fs.setIf((a>>12)&1 == 1, SEV_RESTRICTED) + fs.setIf((a>>13)&1 == 1, SEV_ALTERNATIVE) + fs.setIf((a>>14)&1 == 1, SEV_DEBUGSWAP) + fs.setIf((a>>15)&1 == 1, IBS_PREVENTHOST) + fs.setIf((a>>16)&1 == 1, VTE) + fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) + } + + if mfi >= 0x21 { + // Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21). + _, ebx, ecx, edx := cpuid(0x21) + identity := string(valAsString(ebx, edx, ecx)) + fs.setIf(identity == "IntelTDX ", TDX_GUEST) + } + + return fs +} + +func valAsString(values ...uint32) []byte { + r := make([]byte, 4*len(values)) + for i, v := range values { + dst := r[i*4:] + dst[0] = byte(v & 0xff) + dst[1] = byte((v >> 8) & 0xff) + dst[2] = byte((v >> 16) & 0xff) + dst[3] = byte((v >> 24) & 0xff) + switch { + case dst[0] == 0: + return r[:i*4] + case dst[1] == 0: + return r[:i*4+1] + case dst[2] == 0: + return r[:i*4+2] + case dst[3] == 0: + return r[:i*4+3] + } + } + return r +} diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_386.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_386.s new file mode 100644 index 000000000..8587c3a1f --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_386.s @@ -0,0 +1,47 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//+build 386,!gccgo,!noasm,!appengine + +// func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32) +TEXT ·asmCpuid(SB), 7, $0 + XORL CX, CX + MOVL op+0(FP), AX + CPUID + MOVL AX, eax+4(FP) + MOVL BX, ebx+8(FP) + MOVL CX, ecx+12(FP) + MOVL DX, edx+16(FP) + RET + +// func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) +TEXT ·asmCpuidex(SB), 7, $0 + MOVL op+0(FP), AX + MOVL op2+4(FP), CX + CPUID + MOVL AX, eax+8(FP) + MOVL BX, ebx+12(FP) + MOVL CX, ecx+16(FP) + MOVL DX, edx+20(FP) + RET + +// func xgetbv(index uint32) (eax, edx uint32) +TEXT ·asmXgetbv(SB), 7, $0 + MOVL index+0(FP), CX + BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV + MOVL AX, eax+4(FP) + MOVL DX, edx+8(FP) + RET + +// func asmRdtscpAsm() (eax, ebx, ecx, edx uint32) +TEXT ·asmRdtscpAsm(SB), 7, $0 + BYTE $0x0F; BYTE $0x01; BYTE $0xF9 // RDTSCP + MOVL AX, eax+0(FP) + MOVL BX, ebx+4(FP) + MOVL CX, ecx+8(FP) + MOVL DX, edx+12(FP) + RET + +// func asmDarwinHasAVX512() bool +TEXT ·asmDarwinHasAVX512(SB), 7, $0 + MOVL $0, eax+0(FP) + RET diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s new file mode 100644 index 000000000..bc11f8942 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_amd64.s @@ -0,0 +1,72 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//+build amd64,!gccgo,!noasm,!appengine + +// func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32) +TEXT ·asmCpuid(SB), 7, $0 + XORQ CX, CX + MOVL op+0(FP), AX + CPUID + MOVL AX, eax+8(FP) + MOVL BX, ebx+12(FP) + MOVL CX, ecx+16(FP) + MOVL DX, edx+20(FP) + RET + +// func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) +TEXT ·asmCpuidex(SB), 7, $0 + MOVL op+0(FP), AX + MOVL op2+4(FP), CX + CPUID + MOVL AX, eax+8(FP) + MOVL BX, ebx+12(FP) + MOVL CX, ecx+16(FP) + MOVL DX, edx+20(FP) + RET + +// func asmXgetbv(index uint32) (eax, edx uint32) +TEXT ·asmXgetbv(SB), 7, $0 + MOVL index+0(FP), CX + BYTE $0x0f; BYTE $0x01; BYTE $0xd0 // XGETBV + MOVL AX, eax+8(FP) + MOVL DX, edx+12(FP) + RET + +// func asmRdtscpAsm() (eax, ebx, ecx, edx uint32) +TEXT ·asmRdtscpAsm(SB), 7, $0 + BYTE $0x0F; BYTE $0x01; BYTE $0xF9 // RDTSCP + MOVL AX, eax+0(FP) + MOVL BX, ebx+4(FP) + MOVL CX, ecx+8(FP) + MOVL DX, edx+12(FP) + RET + +// From https://go-review.googlesource.com/c/sys/+/285572/ +// func asmDarwinHasAVX512() bool +TEXT ·asmDarwinHasAVX512(SB), 7, $0-1 + MOVB $0, ret+0(FP) // default to false + +#ifdef GOOS_darwin // return if not darwin +#ifdef GOARCH_amd64 // return if not amd64 +// These values from: +// https://github.com/apple/darwin-xnu/blob/xnu-4570.1.46/osfmk/i386/cpu_capabilities.h +#define commpage64_base_address 0x00007fffffe00000 +#define commpage64_cpu_capabilities64 (commpage64_base_address+0x010) +#define commpage64_version (commpage64_base_address+0x01E) +#define hasAVX512F 0x0000004000000000 + MOVQ $commpage64_version, BX + MOVW (BX), AX + CMPW AX, $13 // versions < 13 do not support AVX512 + JL no_avx512 + MOVQ $commpage64_cpu_capabilities64, BX + MOVQ (BX), AX + MOVQ $hasAVX512F, CX + ANDQ CX, AX + JZ no_avx512 + MOVB $1, ret+0(FP) + +no_avx512: +#endif +#endif + RET + diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s new file mode 100644 index 000000000..b31d6aec4 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid_arm64.s @@ -0,0 +1,26 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//+build arm64,!gccgo,!noasm,!appengine + +// See https://www.kernel.org/doc/Documentation/arm64/cpu-feature-registers.txt + +// func getMidr +TEXT ·getMidr(SB), 7, $0 + WORD $0xd5380000 // mrs x0, midr_el1 /* Main ID Register */ + MOVD R0, midr+0(FP) + RET + +// func getProcFeatures +TEXT ·getProcFeatures(SB), 7, $0 + WORD $0xd5380400 // mrs x0, id_aa64pfr0_el1 /* Processor Feature Register 0 */ + MOVD R0, procFeatures+0(FP) + RET + +// func getInstAttributes +TEXT ·getInstAttributes(SB), 7, $0 + WORD $0xd5380600 // mrs x0, id_aa64isar0_el1 /* Instruction Set Attribute Register 0 */ + WORD $0xd5380621 // mrs x1, id_aa64isar1_el1 /* Instruction Set Attribute Register 1 */ + MOVD R0, instAttrReg0+0(FP) + MOVD R1, instAttrReg1+8(FP) + RET + diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go new file mode 100644 index 000000000..9a53504a0 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/detect_arm64.go @@ -0,0 +1,247 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//go:build arm64 && !gccgo && !noasm && !appengine +// +build arm64,!gccgo,!noasm,!appengine + +package cpuid + +import "runtime" + +func getMidr() (midr uint64) +func getProcFeatures() (procFeatures uint64) +func getInstAttributes() (instAttrReg0, instAttrReg1 uint64) + +func initCPU() { + cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } + cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } + xgetbv = func(uint32) (a, b uint32) { return 0, 0 } + rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 } +} + +func addInfo(c *CPUInfo, safe bool) { + // Seems to be safe to assume on ARM64 + c.CacheLine = 64 + detectOS(c) + + // ARM64 disabled since it may crash if interrupt is not intercepted by OS. + if safe && !c.Supports(ARMCPUID) && runtime.GOOS != "freebsd" { + return + } + midr := getMidr() + + // MIDR_EL1 - Main ID Register + // https://developer.arm.com/docs/ddi0595/h/aarch64-system-registers/midr_el1 + // x--------------------------------------------------x + // | Name | bits | visible | + // |--------------------------------------------------| + // | Implementer | [31-24] | y | + // |--------------------------------------------------| + // | Variant | [23-20] | y | + // |--------------------------------------------------| + // | Architecture | [19-16] | y | + // |--------------------------------------------------| + // | PartNum | [15-4] | y | + // |--------------------------------------------------| + // | Revision | [3-0] | y | + // x--------------------------------------------------x + + switch (midr >> 24) & 0xff { + case 0xC0: + c.VendorString = "Ampere Computing" + c.VendorID = Ampere + case 0x41: + c.VendorString = "Arm Limited" + c.VendorID = ARM + case 0x42: + c.VendorString = "Broadcom Corporation" + c.VendorID = Broadcom + case 0x43: + c.VendorString = "Cavium Inc" + c.VendorID = Cavium + case 0x44: + c.VendorString = "Digital Equipment Corporation" + c.VendorID = DEC + case 0x46: + c.VendorString = "Fujitsu Ltd" + c.VendorID = Fujitsu + case 0x49: + c.VendorString = "Infineon Technologies AG" + c.VendorID = Infineon + case 0x4D: + c.VendorString = "Motorola or Freescale Semiconductor Inc" + c.VendorID = Motorola + case 0x4E: + c.VendorString = "NVIDIA Corporation" + c.VendorID = NVIDIA + case 0x50: + c.VendorString = "Applied Micro Circuits Corporation" + c.VendorID = AMCC + case 0x51: + c.VendorString = "Qualcomm Inc" + c.VendorID = Qualcomm + case 0x56: + c.VendorString = "Marvell International Ltd" + c.VendorID = Marvell + case 0x69: + c.VendorString = "Intel Corporation" + c.VendorID = Intel + } + + // Lower 4 bits: Architecture + // Architecture Meaning + // 0b0001 Armv4. + // 0b0010 Armv4T. + // 0b0011 Armv5 (obsolete). + // 0b0100 Armv5T. + // 0b0101 Armv5TE. + // 0b0110 Armv5TEJ. + // 0b0111 Armv6. + // 0b1111 Architectural features are individually identified in the ID_* registers, see 'ID registers'. + // Upper 4 bit: Variant + // An IMPLEMENTATION DEFINED variant number. + // Typically, this field is used to distinguish between different product variants, or major revisions of a product. + c.Family = int(midr>>16) & 0xff + + // PartNum, bits [15:4] + // An IMPLEMENTATION DEFINED primary part number for the device. + // On processors implemented by Arm, if the top four bits of the primary + // part number are 0x0 or 0x7, the variant and architecture are encoded differently. + // Revision, bits [3:0] + // An IMPLEMENTATION DEFINED revision number for the device. + c.Model = int(midr) & 0xffff + + procFeatures := getProcFeatures() + + // ID_AA64PFR0_EL1 - Processor Feature Register 0 + // x--------------------------------------------------x + // | Name | bits | visible | + // |--------------------------------------------------| + // | DIT | [51-48] | y | + // |--------------------------------------------------| + // | SVE | [35-32] | y | + // |--------------------------------------------------| + // | GIC | [27-24] | n | + // |--------------------------------------------------| + // | AdvSIMD | [23-20] | y | + // |--------------------------------------------------| + // | FP | [19-16] | y | + // |--------------------------------------------------| + // | EL3 | [15-12] | n | + // |--------------------------------------------------| + // | EL2 | [11-8] | n | + // |--------------------------------------------------| + // | EL1 | [7-4] | n | + // |--------------------------------------------------| + // | EL0 | [3-0] | n | + // x--------------------------------------------------x + + var f flagSet + // if procFeatures&(0xf<<48) != 0 { + // fmt.Println("DIT") + // } + f.setIf(procFeatures&(0xf<<32) != 0, SVE) + if procFeatures&(0xf<<20) != 15<<20 { + f.set(ASIMD) + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64pfr0_el1 + // 0b0001 --> As for 0b0000, and also includes support for half-precision floating-point arithmetic. + f.setIf(procFeatures&(0xf<<20) == 1<<20, FPHP, ASIMDHP) + } + f.setIf(procFeatures&(0xf<<16) != 0, FP) + + instAttrReg0, instAttrReg1 := getInstAttributes() + + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1 + // + // ID_AA64ISAR0_EL1 - Instruction Set Attribute Register 0 + // x--------------------------------------------------x + // | Name | bits | visible | + // |--------------------------------------------------| + // | TS | [55-52] | y | + // |--------------------------------------------------| + // | FHM | [51-48] | y | + // |--------------------------------------------------| + // | DP | [47-44] | y | + // |--------------------------------------------------| + // | SM4 | [43-40] | y | + // |--------------------------------------------------| + // | SM3 | [39-36] | y | + // |--------------------------------------------------| + // | SHA3 | [35-32] | y | + // |--------------------------------------------------| + // | RDM | [31-28] | y | + // |--------------------------------------------------| + // | ATOMICS | [23-20] | y | + // |--------------------------------------------------| + // | CRC32 | [19-16] | y | + // |--------------------------------------------------| + // | SHA2 | [15-12] | y | + // |--------------------------------------------------| + // | SHA1 | [11-8] | y | + // |--------------------------------------------------| + // | AES | [7-4] | y | + // x--------------------------------------------------x + + // if instAttrReg0&(0xf<<52) != 0 { + // fmt.Println("TS") + // } + // if instAttrReg0&(0xf<<48) != 0 { + // fmt.Println("FHM") + // } + f.setIf(instAttrReg0&(0xf<<44) != 0, ASIMDDP) + f.setIf(instAttrReg0&(0xf<<40) != 0, SM4) + f.setIf(instAttrReg0&(0xf<<36) != 0, SM3) + f.setIf(instAttrReg0&(0xf<<32) != 0, SHA3) + f.setIf(instAttrReg0&(0xf<<28) != 0, ASIMDRDM) + f.setIf(instAttrReg0&(0xf<<20) != 0, ATOMICS) + f.setIf(instAttrReg0&(0xf<<16) != 0, CRC32) + f.setIf(instAttrReg0&(0xf<<12) != 0, SHA2) + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1 + // 0b0010 --> As 0b0001, plus SHA512H, SHA512H2, SHA512SU0, and SHA512SU1 instructions implemented. + f.setIf(instAttrReg0&(0xf<<12) == 2<<12, SHA512) + f.setIf(instAttrReg0&(0xf<<8) != 0, SHA1) + f.setIf(instAttrReg0&(0xf<<4) != 0, AESARM) + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar0_el1 + // 0b0010 --> As for 0b0001, plus PMULL/PMULL2 instructions operating on 64-bit data quantities. + f.setIf(instAttrReg0&(0xf<<4) == 2<<4, PMULL) + + // https://developer.arm.com/docs/ddi0595/b/aarch64-system-registers/id_aa64isar1_el1 + // + // ID_AA64ISAR1_EL1 - Instruction set attribute register 1 + // x--------------------------------------------------x + // | Name | bits | visible | + // |--------------------------------------------------| + // | GPI | [31-28] | y | + // |--------------------------------------------------| + // | GPA | [27-24] | y | + // |--------------------------------------------------| + // | LRCPC | [23-20] | y | + // |--------------------------------------------------| + // | FCMA | [19-16] | y | + // |--------------------------------------------------| + // | JSCVT | [15-12] | y | + // |--------------------------------------------------| + // | API | [11-8] | y | + // |--------------------------------------------------| + // | APA | [7-4] | y | + // |--------------------------------------------------| + // | DPB | [3-0] | y | + // x--------------------------------------------------x + + // if instAttrReg1&(0xf<<28) != 0 { + // fmt.Println("GPI") + // } + f.setIf(instAttrReg1&(0xf<<28) != 24, GPA) + f.setIf(instAttrReg1&(0xf<<20) != 0, LRCPC) + f.setIf(instAttrReg1&(0xf<<16) != 0, FCMA) + f.setIf(instAttrReg1&(0xf<<12) != 0, JSCVT) + // if instAttrReg1&(0xf<<8) != 0 { + // fmt.Println("API") + // } + // if instAttrReg1&(0xf<<4) != 0 { + // fmt.Println("APA") + // } + f.setIf(instAttrReg1&(0xf<<0) != 0, DCPOP) + + // Store + c.featureSet.or(f) +} diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_ref.go b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go new file mode 100644 index 000000000..9636c2bc1 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/detect_ref.go @@ -0,0 +1,15 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//go:build (!amd64 && !386 && !arm64) || gccgo || noasm || appengine +// +build !amd64,!386,!arm64 gccgo noasm appengine + +package cpuid + +func initCPU() { + cpuid = func(uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } + cpuidex = func(x, y uint32) (a, b, c, d uint32) { return 0, 0, 0, 0 } + xgetbv = func(uint32) (a, b uint32) { return 0, 0 } + rdtscpAsm = func() (a, b, c, d uint32) { return 0, 0, 0, 0 } +} + +func addInfo(info *CPUInfo, safe bool) {} diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go new file mode 100644 index 000000000..c946824ec --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -0,0 +1,36 @@ +// Copyright (c) 2015 Klaus Post, released under MIT License. See LICENSE file. + +//go:build (386 && !gccgo && !noasm && !appengine) || (amd64 && !gccgo && !noasm && !appengine) +// +build 386,!gccgo,!noasm,!appengine amd64,!gccgo,!noasm,!appengine + +package cpuid + +func asmCpuid(op uint32) (eax, ebx, ecx, edx uint32) +func asmCpuidex(op, op2 uint32) (eax, ebx, ecx, edx uint32) +func asmXgetbv(index uint32) (eax, edx uint32) +func asmRdtscpAsm() (eax, ebx, ecx, edx uint32) +func asmDarwinHasAVX512() bool + +func initCPU() { + cpuid = asmCpuid + cpuidex = asmCpuidex + xgetbv = asmXgetbv + rdtscpAsm = asmRdtscpAsm + darwinHasAVX512 = asmDarwinHasAVX512 +} + +func addInfo(c *CPUInfo, safe bool) { + c.maxFunc = maxFunctionID() + c.maxExFunc = maxExtendedFunction() + c.BrandName = brandName() + c.CacheLine = cacheLine() + c.Family, c.Model, c.Stepping = familyModel() + c.featureSet = support() + c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC)) + c.ThreadsPerCore = threadsPerCore() + c.LogicalCores = logicalCores() + c.PhysicalCores = physicalCores() + c.VendorID, c.VendorString = vendorID() + c.cacheSize() + c.frequencies() +} diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go new file mode 100644 index 000000000..024c706af --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -0,0 +1,272 @@ +// Code generated by "stringer -type=FeatureID,Vendor"; DO NOT EDIT. + +package cpuid + +import "strconv" + +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[ADX-1] + _ = x[AESNI-2] + _ = x[AMD3DNOW-3] + _ = x[AMD3DNOWEXT-4] + _ = x[AMXBF16-5] + _ = x[AMXFP16-6] + _ = x[AMXINT8-7] + _ = x[AMXTILE-8] + _ = x[AVX-9] + _ = x[AVX2-10] + _ = x[AVX512BF16-11] + _ = x[AVX512BITALG-12] + _ = x[AVX512BW-13] + _ = x[AVX512CD-14] + _ = x[AVX512DQ-15] + _ = x[AVX512ER-16] + _ = x[AVX512F-17] + _ = x[AVX512FP16-18] + _ = x[AVX512IFMA-19] + _ = x[AVX512PF-20] + _ = x[AVX512VBMI-21] + _ = x[AVX512VBMI2-22] + _ = x[AVX512VL-23] + _ = x[AVX512VNNI-24] + _ = x[AVX512VP2INTERSECT-25] + _ = x[AVX512VPOPCNTDQ-26] + _ = x[AVXIFMA-27] + _ = x[AVXNECONVERT-28] + _ = x[AVXSLOW-29] + _ = x[AVXVNNI-30] + _ = x[AVXVNNIINT8-31] + _ = x[BHI_CTRL-32] + _ = x[BMI1-33] + _ = x[BMI2-34] + _ = x[CETIBT-35] + _ = x[CETSS-36] + _ = x[CLDEMOTE-37] + _ = x[CLMUL-38] + _ = x[CLZERO-39] + _ = x[CMOV-40] + _ = x[CMPCCXADD-41] + _ = x[CMPSB_SCADBS_SHORT-42] + _ = x[CMPXCHG8-43] + _ = x[CPBOOST-44] + _ = x[CPPC-45] + _ = x[CX16-46] + _ = x[EFER_LMSLE_UNS-47] + _ = x[ENQCMD-48] + _ = x[ERMS-49] + _ = x[F16C-50] + _ = x[FLUSH_L1D-51] + _ = x[FMA3-52] + _ = x[FMA4-53] + _ = x[FP128-54] + _ = x[FP256-55] + _ = x[FSRM-56] + _ = x[FXSR-57] + _ = x[FXSROPT-58] + _ = x[GFNI-59] + _ = x[HLE-60] + _ = x[HRESET-61] + _ = x[HTT-62] + _ = x[HWA-63] + _ = x[HYBRID_CPU-64] + _ = x[HYPERVISOR-65] + _ = x[IA32_ARCH_CAP-66] + _ = x[IA32_CORE_CAP-67] + _ = x[IBPB-68] + _ = x[IBRS-69] + _ = x[IBRS_PREFERRED-70] + _ = x[IBRS_PROVIDES_SMP-71] + _ = x[IBS-72] + _ = x[IBSBRNTRGT-73] + _ = x[IBSFETCHSAM-74] + _ = x[IBSFFV-75] + _ = x[IBSOPCNT-76] + _ = x[IBSOPCNTEXT-77] + _ = x[IBSOPSAM-78] + _ = x[IBSRDWROPCNT-79] + _ = x[IBSRIPINVALIDCHK-80] + _ = x[IBS_FETCH_CTLX-81] + _ = x[IBS_OPDATA4-82] + _ = x[IBS_OPFUSE-83] + _ = x[IBS_PREVENTHOST-84] + _ = x[IBS_ZEN4-85] + _ = x[IDPRED_CTRL-86] + _ = x[INT_WBINVD-87] + _ = x[INVLPGB-88] + _ = x[LAHF-89] + _ = x[LAM-90] + _ = x[LBRVIRT-91] + _ = x[LZCNT-92] + _ = x[MCAOVERFLOW-93] + _ = x[MCDT_NO-94] + _ = x[MCOMMIT-95] + _ = x[MD_CLEAR-96] + _ = x[MMX-97] + _ = x[MMXEXT-98] + _ = x[MOVBE-99] + _ = x[MOVDIR64B-100] + _ = x[MOVDIRI-101] + _ = x[MOVSB_ZL-102] + _ = x[MOVU-103] + _ = x[MPX-104] + _ = x[MSRIRC-105] + _ = x[MSRLIST-106] + _ = x[MSR_PAGEFLUSH-107] + _ = x[NRIPS-108] + _ = x[NX-109] + _ = x[OSXSAVE-110] + _ = x[PCONFIG-111] + _ = x[POPCNT-112] + _ = x[PPIN-113] + _ = x[PREFETCHI-114] + _ = x[PSFD-115] + _ = x[RDPRU-116] + _ = x[RDRAND-117] + _ = x[RDSEED-118] + _ = x[RDTSCP-119] + _ = x[RRSBA_CTRL-120] + _ = x[RTM-121] + _ = x[RTM_ALWAYS_ABORT-122] + _ = x[SERIALIZE-123] + _ = x[SEV-124] + _ = x[SEV_64BIT-125] + _ = x[SEV_ALTERNATIVE-126] + _ = x[SEV_DEBUGSWAP-127] + _ = x[SEV_ES-128] + _ = x[SEV_RESTRICTED-129] + _ = x[SEV_SNP-130] + _ = x[SGX-131] + _ = x[SGXLC-132] + _ = x[SHA-133] + _ = x[SME-134] + _ = x[SME_COHERENT-135] + _ = x[SPEC_CTRL_SSBD-136] + _ = x[SRBDS_CTRL-137] + _ = x[SSE-138] + _ = x[SSE2-139] + _ = x[SSE3-140] + _ = x[SSE4-141] + _ = x[SSE42-142] + _ = x[SSE4A-143] + _ = x[SSSE3-144] + _ = x[STIBP-145] + _ = x[STIBP_ALWAYSON-146] + _ = x[STOSB_SHORT-147] + _ = x[SUCCOR-148] + _ = x[SVM-149] + _ = x[SVMDA-150] + _ = x[SVMFBASID-151] + _ = x[SVML-152] + _ = x[SVMNP-153] + _ = x[SVMPF-154] + _ = x[SVMPFT-155] + _ = x[SYSCALL-156] + _ = x[SYSEE-157] + _ = x[TBM-158] + _ = x[TDX_GUEST-159] + _ = x[TLB_FLUSH_NESTED-160] + _ = x[TME-161] + _ = x[TOPEXT-162] + _ = x[TSCRATEMSR-163] + _ = x[TSXLDTRK-164] + _ = x[VAES-165] + _ = x[VMCBCLEAN-166] + _ = x[VMPL-167] + _ = x[VMSA_REGPROT-168] + _ = x[VMX-169] + _ = x[VPCLMULQDQ-170] + _ = x[VTE-171] + _ = x[WAITPKG-172] + _ = x[WBNOINVD-173] + _ = x[WRMSRNS-174] + _ = x[X87-175] + _ = x[XGETBV1-176] + _ = x[XOP-177] + _ = x[XSAVE-178] + _ = x[XSAVEC-179] + _ = x[XSAVEOPT-180] + _ = x[XSAVES-181] + _ = x[AESARM-182] + _ = x[ARMCPUID-183] + _ = x[ASIMD-184] + _ = x[ASIMDDP-185] + _ = x[ASIMDHP-186] + _ = x[ASIMDRDM-187] + _ = x[ATOMICS-188] + _ = x[CRC32-189] + _ = x[DCPOP-190] + _ = x[EVTSTRM-191] + _ = x[FCMA-192] + _ = x[FP-193] + _ = x[FPHP-194] + _ = x[GPA-195] + _ = x[JSCVT-196] + _ = x[LRCPC-197] + _ = x[PMULL-198] + _ = x[SHA1-199] + _ = x[SHA2-200] + _ = x[SHA3-201] + _ = x[SHA512-202] + _ = x[SM3-203] + _ = x[SM4-204] + _ = x[SVE-205] + _ = x[lastID-206] + _ = x[firstID-0] +} + +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" + +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465} + +func (i FeatureID) String() string { + if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { + return "FeatureID(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _FeatureID_name[_FeatureID_index[i]:_FeatureID_index[i+1]] +} +func _() { + // An "invalid array index" compiler error signifies that the constant values have changed. + // Re-run the stringer command to generate them again. + var x [1]struct{} + _ = x[VendorUnknown-0] + _ = x[Intel-1] + _ = x[AMD-2] + _ = x[VIA-3] + _ = x[Transmeta-4] + _ = x[NSC-5] + _ = x[KVM-6] + _ = x[MSVM-7] + _ = x[VMware-8] + _ = x[XenHVM-9] + _ = x[Bhyve-10] + _ = x[Hygon-11] + _ = x[SiS-12] + _ = x[RDC-13] + _ = x[Ampere-14] + _ = x[ARM-15] + _ = x[Broadcom-16] + _ = x[Cavium-17] + _ = x[DEC-18] + _ = x[Fujitsu-19] + _ = x[Infineon-20] + _ = x[Motorola-21] + _ = x[NVIDIA-22] + _ = x[AMCC-23] + _ = x[Qualcomm-24] + _ = x[Marvell-25] + _ = x[lastVendor-26] +} + +const _Vendor_name = "VendorUnknownIntelAMDVIATransmetaNSCKVMMSVMVMwareXenHVMBhyveHygonSiSRDCAmpereARMBroadcomCaviumDECFujitsuInfineonMotorolaNVIDIAAMCCQualcommMarvelllastVendor" + +var _Vendor_index = [...]uint8{0, 13, 18, 21, 24, 33, 36, 39, 43, 49, 55, 60, 65, 68, 71, 77, 80, 88, 94, 97, 104, 112, 120, 126, 130, 138, 145, 155} + +func (i Vendor) String() string { + if i < 0 || i >= Vendor(len(_Vendor_index)-1) { + return "Vendor(" + strconv.FormatInt(int64(i), 10) + ")" + } + return _Vendor_name[_Vendor_index[i]:_Vendor_index[i+1]] +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go new file mode 100644 index 000000000..84b1acd21 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_darwin_arm64.go @@ -0,0 +1,121 @@ +// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file. + +package cpuid + +import ( + "runtime" + "strings" + + "golang.org/x/sys/unix" +) + +func detectOS(c *CPUInfo) bool { + if runtime.GOOS != "ios" { + tryToFillCPUInfoFomSysctl(c) + } + // There are no hw.optional sysctl values for the below features on Mac OS 11.0 + // to detect their supported state dynamically. Assume the CPU features that + // Apple Silicon M1 supports to be available as a minimal set of features + // to all Go programs running on darwin/arm64. + // TODO: Add more if we know them. + c.featureSet.setIf(runtime.GOOS != "ios", AESARM, PMULL, SHA1, SHA2) + + return true +} + +func sysctlGetBool(name string) bool { + value, err := unix.SysctlUint32(name) + if err != nil { + return false + } + return value != 0 +} + +func sysctlGetString(name string) string { + value, err := unix.Sysctl(name) + if err != nil { + return "" + } + return value +} + +func sysctlGetInt(unknown int, names ...string) int { + for _, name := range names { + value, err := unix.SysctlUint32(name) + if err != nil { + continue + } + if value != 0 { + return int(value) + } + } + return unknown +} + +func sysctlGetInt64(unknown int, names ...string) int { + for _, name := range names { + value64, err := unix.SysctlUint64(name) + if err != nil { + continue + } + if int(value64) != unknown { + return int(value64) + } + } + return unknown +} + +func setFeature(c *CPUInfo, name string, feature FeatureID) { + c.featureSet.setIf(sysctlGetBool(name), feature) +} +func tryToFillCPUInfoFomSysctl(c *CPUInfo) { + c.BrandName = sysctlGetString("machdep.cpu.brand_string") + + if len(c.BrandName) != 0 { + c.VendorString = strings.Fields(c.BrandName)[0] + } + + c.PhysicalCores = sysctlGetInt(runtime.NumCPU(), "hw.physicalcpu") + c.ThreadsPerCore = sysctlGetInt(1, "machdep.cpu.thread_count", "kern.num_threads") / + sysctlGetInt(1, "hw.physicalcpu") + c.LogicalCores = sysctlGetInt(runtime.NumCPU(), "machdep.cpu.core_count") + c.Family = sysctlGetInt(0, "machdep.cpu.family", "hw.cpufamily") + c.Model = sysctlGetInt(0, "machdep.cpu.model") + c.CacheLine = sysctlGetInt64(0, "hw.cachelinesize") + c.Cache.L1I = sysctlGetInt64(-1, "hw.l1icachesize") + c.Cache.L1D = sysctlGetInt64(-1, "hw.l1dcachesize") + c.Cache.L2 = sysctlGetInt64(-1, "hw.l2cachesize") + c.Cache.L3 = sysctlGetInt64(-1, "hw.l3cachesize") + + // from https://developer.arm.com/downloads/-/exploration-tools/feature-names-for-a-profile + setFeature(c, "hw.optional.arm.FEAT_AES", AESARM) + setFeature(c, "hw.optional.AdvSIMD", ASIMD) + setFeature(c, "hw.optional.arm.FEAT_DotProd", ASIMDDP) + setFeature(c, "hw.optional.arm.FEAT_RDM", ASIMDRDM) + setFeature(c, "hw.optional.FEAT_CRC32", CRC32) + setFeature(c, "hw.optional.arm.FEAT_DPB", DCPOP) + // setFeature(c, "", EVTSTRM) + setFeature(c, "hw.optional.arm.FEAT_FCMA", FCMA) + setFeature(c, "hw.optional.arm.FEAT_FP", FP) + setFeature(c, "hw.optional.arm.FEAT_FP16", FPHP) + setFeature(c, "hw.optional.arm.FEAT_PAuth", GPA) + setFeature(c, "hw.optional.arm.FEAT_JSCVT", JSCVT) + setFeature(c, "hw.optional.arm.FEAT_LRCPC", LRCPC) + setFeature(c, "hw.optional.arm.FEAT_PMULL", PMULL) + setFeature(c, "hw.optional.arm.FEAT_SHA1", SHA1) + setFeature(c, "hw.optional.arm.FEAT_SHA256", SHA2) + setFeature(c, "hw.optional.arm.FEAT_SHA3", SHA3) + setFeature(c, "hw.optional.arm.FEAT_SHA512", SHA512) + // setFeature(c, "", SM3) + // setFeature(c, "", SM4) + setFeature(c, "hw.optional.arm.FEAT_SVE", SVE) + + // from empirical observation + setFeature(c, "hw.optional.AdvSIMD_HPFPCvt", ASIMDHP) + setFeature(c, "hw.optional.armv8_1_atomics", ATOMICS) + setFeature(c, "hw.optional.floatingpoint", FP) + setFeature(c, "hw.optional.armv8_2_sha3", SHA3) + setFeature(c, "hw.optional.armv8_2_sha512", SHA512) + setFeature(c, "hw.optional.armv8_3_compnum", FCMA) + setFeature(c, "hw.optional.armv8_crc32", CRC32) +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go new file mode 100644 index 000000000..ee278b9e4 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_linux_arm64.go @@ -0,0 +1,130 @@ +// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file. + +// Copyright 2018 The Go Authors. All rights reserved. +// Use of this source code is governed by a BSD-style +// license that can be found in the LICENSE file located +// here https://github.com/golang/sys/blob/master/LICENSE + +package cpuid + +import ( + "encoding/binary" + "io/ioutil" + "runtime" +) + +// HWCAP bits. +const ( + hwcap_FP = 1 << 0 + hwcap_ASIMD = 1 << 1 + hwcap_EVTSTRM = 1 << 2 + hwcap_AES = 1 << 3 + hwcap_PMULL = 1 << 4 + hwcap_SHA1 = 1 << 5 + hwcap_SHA2 = 1 << 6 + hwcap_CRC32 = 1 << 7 + hwcap_ATOMICS = 1 << 8 + hwcap_FPHP = 1 << 9 + hwcap_ASIMDHP = 1 << 10 + hwcap_CPUID = 1 << 11 + hwcap_ASIMDRDM = 1 << 12 + hwcap_JSCVT = 1 << 13 + hwcap_FCMA = 1 << 14 + hwcap_LRCPC = 1 << 15 + hwcap_DCPOP = 1 << 16 + hwcap_SHA3 = 1 << 17 + hwcap_SM3 = 1 << 18 + hwcap_SM4 = 1 << 19 + hwcap_ASIMDDP = 1 << 20 + hwcap_SHA512 = 1 << 21 + hwcap_SVE = 1 << 22 + hwcap_ASIMDFHM = 1 << 23 +) + +func detectOS(c *CPUInfo) bool { + // For now assuming no hyperthreading is reasonable. + c.LogicalCores = runtime.NumCPU() + c.PhysicalCores = c.LogicalCores + c.ThreadsPerCore = 1 + if hwcap == 0 { + // We did not get values from the runtime. + // Try reading /proc/self/auxv + + // From https://github.com/golang/sys + const ( + _AT_HWCAP = 16 + _AT_HWCAP2 = 26 + + uintSize = int(32 << (^uint(0) >> 63)) + ) + + buf, err := ioutil.ReadFile("/proc/self/auxv") + if err != nil { + // e.g. on android /proc/self/auxv is not accessible, so silently + // ignore the error and leave Initialized = false. On some + // architectures (e.g. arm64) doinit() implements a fallback + // readout and will set Initialized = true again. + return false + } + bo := binary.LittleEndian + for len(buf) >= 2*(uintSize/8) { + var tag, val uint + switch uintSize { + case 32: + tag = uint(bo.Uint32(buf[0:])) + val = uint(bo.Uint32(buf[4:])) + buf = buf[8:] + case 64: + tag = uint(bo.Uint64(buf[0:])) + val = uint(bo.Uint64(buf[8:])) + buf = buf[16:] + } + switch tag { + case _AT_HWCAP: + hwcap = val + case _AT_HWCAP2: + // Not used + } + } + if hwcap == 0 { + return false + } + } + + // HWCap was populated by the runtime from the auxiliary vector. + // Use HWCap information since reading aarch64 system registers + // is not supported in user space on older linux kernels. + c.featureSet.setIf(isSet(hwcap, hwcap_AES), AESARM) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMD), ASIMD) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDDP), ASIMDDP) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDHP), ASIMDHP) + c.featureSet.setIf(isSet(hwcap, hwcap_ASIMDRDM), ASIMDRDM) + c.featureSet.setIf(isSet(hwcap, hwcap_CPUID), ARMCPUID) + c.featureSet.setIf(isSet(hwcap, hwcap_CRC32), CRC32) + c.featureSet.setIf(isSet(hwcap, hwcap_DCPOP), DCPOP) + c.featureSet.setIf(isSet(hwcap, hwcap_EVTSTRM), EVTSTRM) + c.featureSet.setIf(isSet(hwcap, hwcap_FCMA), FCMA) + c.featureSet.setIf(isSet(hwcap, hwcap_FP), FP) + c.featureSet.setIf(isSet(hwcap, hwcap_FPHP), FPHP) + c.featureSet.setIf(isSet(hwcap, hwcap_JSCVT), JSCVT) + c.featureSet.setIf(isSet(hwcap, hwcap_LRCPC), LRCPC) + c.featureSet.setIf(isSet(hwcap, hwcap_PMULL), PMULL) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA1), SHA1) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA2), SHA2) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA3), SHA3) + c.featureSet.setIf(isSet(hwcap, hwcap_SHA512), SHA512) + c.featureSet.setIf(isSet(hwcap, hwcap_SM3), SM3) + c.featureSet.setIf(isSet(hwcap, hwcap_SM4), SM4) + c.featureSet.setIf(isSet(hwcap, hwcap_SVE), SVE) + + // The Samsung S9+ kernel reports support for atomics, but not all cores + // actually support them, resulting in SIGILL. See issue #28431. + // TODO(elias.naur): Only disable the optimization on bad chipsets on android. + c.featureSet.setIf(isSet(hwcap, hwcap_ATOMICS) && runtime.GOOS != "android", ATOMICS) + + return true +} + +func isSet(hwc uint, value uint) bool { + return hwc&value != 0 +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go new file mode 100644 index 000000000..8733ba343 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_other_arm64.go @@ -0,0 +1,16 @@ +// Copyright (c) 2020 Klaus Post, released under MIT License. See LICENSE file. + +//go:build arm64 && !linux && !darwin +// +build arm64,!linux,!darwin + +package cpuid + +import "runtime" + +func detectOS(c *CPUInfo) bool { + c.PhysicalCores = runtime.NumCPU() + // For now assuming 1 thread per core... + c.ThreadsPerCore = 1 + c.LogicalCores = c.PhysicalCores + return false +} diff --git a/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go new file mode 100644 index 000000000..f8f201b5f --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_safe_linux_arm64.go @@ -0,0 +1,8 @@ +// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file. + +//go:build nounsafe +// +build nounsafe + +package cpuid + +var hwcap uint diff --git a/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go new file mode 100644 index 000000000..92af622eb --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/os_unsafe_linux_arm64.go @@ -0,0 +1,11 @@ +// Copyright (c) 2021 Klaus Post, released under MIT License. See LICENSE file. + +//go:build !nounsafe +// +build !nounsafe + +package cpuid + +import _ "unsafe" // needed for go:linkname + +//go:linkname hwcap internal/cpu.HWCap +var hwcap uint diff --git a/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh b/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh new file mode 100644 index 000000000..471d986d2 --- /dev/null +++ b/vendor/github.com/klauspost/cpuid/v2/test-architectures.sh @@ -0,0 +1,15 @@ +#!/bin/sh + +set -e + +go tool dist list | while IFS=/ read os arch; do + echo "Checking $os/$arch..." + echo " normal" + GOARCH=$arch GOOS=$os go build -o /dev/null . + echo " noasm" + GOARCH=$arch GOOS=$os go build -tags noasm -o /dev/null . + echo " appengine" + GOARCH=$arch GOOS=$os go build -tags appengine -o /dev/null . + echo " noasm,appengine" + GOARCH=$arch GOOS=$os go build -tags 'appengine noasm' -o /dev/null . +done -- cgit mrf-deployment