diff options
| author | Aleksandr Nogikh <nogikh@google.com> | 2025-01-02 11:58:29 +0100 |
|---|---|---|
| committer | Aleksandr Nogikh <nogikh@google.com> | 2025-01-22 13:17:53 +0000 |
| commit | 7512e6e7738143bd302d9b20cb1fd0d1d7af9643 (patch) | |
| tree | 67988d580d111bacbd009acfc0057f89aafa6522 /vendor/github.com/klauspost | |
| parent | 44f2ad31190603135f4ac758273f26111ca6003c (diff) | |
vendor: fetch the dependencies
Diffstat (limited to 'vendor/github.com/klauspost')
| -rw-r--r-- | vendor/github.com/klauspost/cpuid/v2/README.md | 15 | ||||
| -rw-r--r-- | vendor/github.com/klauspost/cpuid/v2/cpuid.go | 459 | ||||
| -rw-r--r-- | vendor/github.com/klauspost/cpuid/v2/detect_x86.go | 2 | ||||
| -rw-r--r-- | vendor/github.com/klauspost/cpuid/v2/featureid_string.go | 413 |
4 files changed, 499 insertions, 390 deletions
diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md index accd7abaf..21508edbd 100644 --- a/vendor/github.com/klauspost/cpuid/v2/README.md +++ b/vendor/github.com/klauspost/cpuid/v2/README.md @@ -9,10 +9,7 @@ You can access the CPU information by accessing the shared CPU variable of the c Package home: https://github.com/klauspost/cpuid [](https://pkg.go.dev/github.com/klauspost/cpuid/v2) -[![Build Status][3]][4] - -[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master -[4]: https://travis-ci.org/klauspost/cpuid +[](https://github.com/klauspost/cpuid/actions/workflows/go.yml) ## installing @@ -285,7 +282,12 @@ Exit Code 1 | AMXINT8 | Tile computational operations on 8-bit integers | | AMXFP16 | Tile computational operations on FP16 numbers | | AMXTILE | Tile architecture | +| APX_F | Intel APX | | AVX | AVX functions | +| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported | +| AVX10_128 | If set indicates that AVX10 128-bit vector support is present | +| AVX10_256 | If set indicates that AVX10 256-bit vector support is present | +| AVX10_512 | If set indicates that AVX10 512-bit vector support is present | | AVX2 | AVX2 functions | | AVX512BF16 | AVX-512 BFLOAT16 Instructions | | AVX512BITALG | AVX-512 Bit Algorithms | @@ -308,6 +310,7 @@ Exit Code 1 | AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one | | AVXVNNI | AVX (VEX encoded) VNNI neural network instructions | | AVXVNNIINT8 | AVX-VNNI-INT8 instructions | +| AVXVNNIINT16 | AVX-VNNI-INT16 instructions | | BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 | | BMI1 | Bit Manipulation Instruction Set 1 | | BMI2 | Bit Manipulation Instruction Set 2 | @@ -365,6 +368,8 @@ Exit Code 1 | IDPRED_CTRL | IPRED_DIS | | INT_WBINVD | WBINVD/WBNOINVD are interruptible. | | INVLPGB | NVLPGB and TLBSYNC instruction supported | +| KEYLOCKER | Key locker | +| KEYLOCKERW | Key locker wide | | LAHF | LAHF/SAHF in long mode | | LAM | If set, CPU supports Linear Address Masking | | LBRVIRT | LBR virtualization | @@ -380,7 +385,7 @@ Exit Code 1 | MOVDIRI | Move Doubleword as Direct Store | | MOVSB_ZL | Fast Zero-Length MOVSB | | MPX | Intel MPX (Memory Protection Extensions) | -| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | +| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD | | MSRIRC | Instruction Retired Counter MSR available | | MSRLIST | Read/Write List of Model Specific Registers | | MSR_PAGEFLUSH | Page Flush MSR available | diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go index d015c744e..53bc18ca7 100644 --- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go +++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go @@ -67,188 +67,201 @@ const ( // Keep index -1 as unknown UNKNOWN = -1 - // Add features - ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions) - AESNI // Advanced Encryption Standard New Instructions - AMD3DNOW // AMD 3DNOW - AMD3DNOWEXT // AMD 3DNowExt - AMXBF16 // Tile computational operations on BFLOAT16 numbers - AMXFP16 // Tile computational operations on FP16 numbers - AMXINT8 // Tile computational operations on 8-bit integers - AMXTILE // Tile architecture - AVX // AVX functions - AVX2 // AVX2 functions - AVX512BF16 // AVX-512 BFLOAT16 Instructions - AVX512BITALG // AVX-512 Bit Algorithms - AVX512BW // AVX-512 Byte and Word Instructions - AVX512CD // AVX-512 Conflict Detection Instructions - AVX512DQ // AVX-512 Doubleword and Quadword Instructions - AVX512ER // AVX-512 Exponential and Reciprocal Instructions - AVX512F // AVX-512 Foundation - AVX512FP16 // AVX-512 FP16 Instructions - AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions - AVX512PF // AVX-512 Prefetch Instructions - AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions - AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2 - AVX512VL // AVX-512 Vector Length Extensions - AVX512VNNI // AVX-512 Vector Neural Network Instructions - AVX512VP2INTERSECT // AVX-512 Intersect for D/Q - AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword - AVXIFMA // AVX-IFMA instructions - AVXNECONVERT // AVX-NE-CONVERT instructions - AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one - AVXVNNI // AVX (VEX encoded) VNNI neural network instructions - AVXVNNIINT8 // AVX-VNNI-INT8 instructions - BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 - BMI1 // Bit Manipulation Instruction Set 1 - BMI2 // Bit Manipulation Instruction Set 2 - CETIBT // Intel CET Indirect Branch Tracking - CETSS // Intel CET Shadow Stack - CLDEMOTE // Cache Line Demote - CLMUL // Carry-less Multiplication - CLZERO // CLZERO instruction supported - CMOV // i686 CMOV - CMPCCXADD // CMPCCXADD instructions - CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB - CMPXCHG8 // CMPXCHG8 instruction - CPBOOST // Core Performance Boost - CPPC // AMD: Collaborative Processor Performance Control - CX16 // CMPXCHG16B Instruction - EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ - ENQCMD // Enqueue Command - ERMS // Enhanced REP MOVSB/STOSB - F16C // Half-precision floating-point conversion - FLUSH_L1D // Flush L1D cache - FMA3 // Intel FMA 3. Does not imply AVX. - FMA4 // Bulldozer FMA4 functions - FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide - FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide - FSRM // Fast Short Rep Mov - FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 - FXSROPT // FXSAVE/FXRSTOR optimizations - GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. - HLE // Hardware Lock Elision - HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR - HTT // Hyperthreading (enabled) - HWA // Hardware assert supported. Indicates support for MSRC001_10 - HYBRID_CPU // This part has CPUs of more than one type. - HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors - IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) - IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR - IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) - IBRS // AMD: Indirect Branch Restricted Speculation - IBRS_PREFERRED // AMD: IBRS is preferred over software solution - IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection - IBS // Instruction Based Sampling (AMD) - IBSBRNTRGT // Instruction Based Sampling Feature (AMD) - IBSFETCHSAM // Instruction Based Sampling Feature (AMD) - IBSFFV // Instruction Based Sampling Feature (AMD) - IBSOPCNT // Instruction Based Sampling Feature (AMD) - IBSOPCNTEXT // Instruction Based Sampling Feature (AMD) - IBSOPSAM // Instruction Based Sampling Feature (AMD) - IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) - IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) - IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported - IBS_OPDATA4 // AMD: IBS op data 4 MSR supported - IBS_OPFUSE // AMD: Indicates support for IbsOpFuse - IBS_PREVENTHOST // Disallowing IBS use by the host supported - IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4 - IDPRED_CTRL // IPRED_DIS - INT_WBINVD // WBINVD/WBNOINVD are interruptible. - INVLPGB // NVLPGB and TLBSYNC instruction supported - LAHF // LAHF/SAHF in long mode - LAM // If set, CPU supports Linear Address Masking - LBRVIRT // LBR virtualization - LZCNT // LZCNT instruction - MCAOVERFLOW // MCA overflow recovery support. - MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. - MCOMMIT // MCOMMIT instruction supported - MD_CLEAR // VERW clears CPU buffers - MMX // standard MMX - MMXEXT // SSE integer functions or AMD MMX ext - MOVBE // MOVBE instruction (big-endian) - MOVDIR64B // Move 64 Bytes as Direct Store - MOVDIRI // Move Doubleword as Direct Store - MOVSB_ZL // Fast Zero-Length MOVSB - MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD - MPX // Intel MPX (Memory Protection Extensions) - MSRIRC // Instruction Retired Counter MSR available - MSRLIST // Read/Write List of Model Specific Registers - MSR_PAGEFLUSH // Page Flush MSR available - NRIPS // Indicates support for NRIP save on VMEXIT - NX // NX (No-Execute) bit - OSXSAVE // XSAVE enabled by OS - PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption - POPCNT // POPCNT instruction - PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled - PREFETCHI // PREFETCHIT0/1 instructions - PSFD // Predictive Store Forward Disable - RDPRU // RDPRU instruction supported - RDRAND // RDRAND instruction is available - RDSEED // RDSEED instruction is available - RDTSCP // RDTSCP Instruction - RRSBA_CTRL // Restricted RSB Alternate - RTM // Restricted Transactional Memory - RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. - SERIALIZE // Serialize Instruction Execution - SEV // AMD Secure Encrypted Virtualization supported - SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host - SEV_ALTERNATIVE // AMD SEV Alternate Injection supported - SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests - SEV_ES // AMD SEV Encrypted State supported - SEV_RESTRICTED // AMD SEV Restricted Injection supported - SEV_SNP // AMD SEV Secure Nested Paging supported - SGX // Software Guard Extensions - SGXLC // Software Guard Extensions Launch Control - SHA // Intel SHA Extensions - SME // AMD Secure Memory Encryption supported - SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced - SPEC_CTRL_SSBD // Speculative Store Bypass Disable - SRBDS_CTRL // SRBDS mitigation MSR available - SSE // SSE functions - SSE2 // P4 SSE functions - SSE3 // Prescott SSE3 functions - SSE4 // Penryn SSE4.1 functions - SSE42 // Nehalem SSE4.2 functions - SSE4A // AMD Barcelona microarchitecture SSE4a instructions - SSSE3 // Conroe SSSE3 functions - STIBP // Single Thread Indirect Branch Predictors - STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On - STOSB_SHORT // Fast short STOSB - SUCCOR // Software uncorrectable error containment and recovery capability. - SVM // AMD Secure Virtual Machine - SVMDA // Indicates support for the SVM decode assists. - SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control - SVML // AMD SVM lock. Indicates support for SVM-Lock. - SVMNP // AMD SVM nested paging - SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter - SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold - SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. - SYSEE // SYSENTER and SYSEXIT instructions - TBM // AMD Trailing Bit Manipulation - TDX_GUEST // Intel Trust Domain Extensions Guest - TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations - TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. - TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. - TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 - TSXLDTRK // Intel TSX Suspend Load Address Tracking - VAES // Vector AES. AVX(512) versions requires additional checks. - VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. - VMPL // AMD VM Permission Levels supported - VMSA_REGPROT // AMD VMSA Register Protection supported - VMX // Virtual Machine Extensions - VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. - VTE // AMD Virtual Transparent Encryption supported - WAITPKG // TPAUSE, UMONITOR, UMWAIT - WBNOINVD // Write Back and Do Not Invalidate Cache - WRMSRNS // Non-Serializing Write to Model Specific Register - X87 // FPU - XGETBV1 // Supports XGETBV with ECX = 1 - XOP // Bulldozer XOP functions - XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV - XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. - XSAVEOPT // XSAVEOPT available - XSAVES // Supports XSAVES/XRSTORS and IA32_XSS + // x86 features + ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions) + AESNI // Advanced Encryption Standard New Instructions + AMD3DNOW // AMD 3DNOW + AMD3DNOWEXT // AMD 3DNowExt + AMXBF16 // Tile computational operations on BFLOAT16 numbers + AMXFP16 // Tile computational operations on FP16 numbers + AMXINT8 // Tile computational operations on 8-bit integers + AMXTILE // Tile architecture + APX_F // Intel APX + AVX // AVX functions + AVX10 // If set the Intel AVX10 Converged Vector ISA is supported + AVX10_128 // If set indicates that AVX10 128-bit vector support is present + AVX10_256 // If set indicates that AVX10 256-bit vector support is present + AVX10_512 // If set indicates that AVX10 512-bit vector support is present + AVX2 // AVX2 functions + AVX512BF16 // AVX-512 BFLOAT16 Instructions + AVX512BITALG // AVX-512 Bit Algorithms + AVX512BW // AVX-512 Byte and Word Instructions + AVX512CD // AVX-512 Conflict Detection Instructions + AVX512DQ // AVX-512 Doubleword and Quadword Instructions + AVX512ER // AVX-512 Exponential and Reciprocal Instructions + AVX512F // AVX-512 Foundation + AVX512FP16 // AVX-512 FP16 Instructions + AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions + AVX512PF // AVX-512 Prefetch Instructions + AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions + AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2 + AVX512VL // AVX-512 Vector Length Extensions + AVX512VNNI // AVX-512 Vector Neural Network Instructions + AVX512VP2INTERSECT // AVX-512 Intersect for D/Q + AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword + AVXIFMA // AVX-IFMA instructions + AVXNECONVERT // AVX-NE-CONVERT instructions + AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one + AVXVNNI // AVX (VEX encoded) VNNI neural network instructions + AVXVNNIINT8 // AVX-VNNI-INT8 instructions + AVXVNNIINT16 // AVX-VNNI-INT16 instructions + BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 + BMI1 // Bit Manipulation Instruction Set 1 + BMI2 // Bit Manipulation Instruction Set 2 + CETIBT // Intel CET Indirect Branch Tracking + CETSS // Intel CET Shadow Stack + CLDEMOTE // Cache Line Demote + CLMUL // Carry-less Multiplication + CLZERO // CLZERO instruction supported + CMOV // i686 CMOV + CMPCCXADD // CMPCCXADD instructions + CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB + CMPXCHG8 // CMPXCHG8 instruction + CPBOOST // Core Performance Boost + CPPC // AMD: Collaborative Processor Performance Control + CX16 // CMPXCHG16B Instruction + EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ + ENQCMD // Enqueue Command + ERMS // Enhanced REP MOVSB/STOSB + F16C // Half-precision floating-point conversion + FLUSH_L1D // Flush L1D cache + FMA3 // Intel FMA 3. Does not imply AVX. + FMA4 // Bulldozer FMA4 functions + FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide + FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide + FSRM // Fast Short Rep Mov + FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9 + FXSROPT // FXSAVE/FXRSTOR optimizations + GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage. + HLE // Hardware Lock Elision + HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR + HTT // Hyperthreading (enabled) + HWA // Hardware assert supported. Indicates support for MSRC001_10 + HYBRID_CPU // This part has CPUs of more than one type. + HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors + IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel) + IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR + IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB) + IBPB_BRTYPE // Indicates that MSR 49h (PRED_CMD) bit 0 (IBPB) flushes all branch type predictions from the CPU branch predictor + IBRS // AMD: Indirect Branch Restricted Speculation + IBRS_PREFERRED // AMD: IBRS is preferred over software solution + IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection + IBS // Instruction Based Sampling (AMD) + IBSBRNTRGT // Instruction Based Sampling Feature (AMD) + IBSFETCHSAM // Instruction Based Sampling Feature (AMD) + IBSFFV // Instruction Based Sampling Feature (AMD) + IBSOPCNT // Instruction Based Sampling Feature (AMD) + IBSOPCNTEXT // Instruction Based Sampling Feature (AMD) + IBSOPSAM // Instruction Based Sampling Feature (AMD) + IBSRDWROPCNT // Instruction Based Sampling Feature (AMD) + IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD) + IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported + IBS_OPDATA4 // AMD: IBS op data 4 MSR supported + IBS_OPFUSE // AMD: Indicates support for IbsOpFuse + IBS_PREVENTHOST // Disallowing IBS use by the host supported + IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4 + IDPRED_CTRL // IPRED_DIS + INT_WBINVD // WBINVD/WBNOINVD are interruptible. + INVLPGB // NVLPGB and TLBSYNC instruction supported + KEYLOCKER // Key locker + KEYLOCKERW // Key locker wide + LAHF // LAHF/SAHF in long mode + LAM // If set, CPU supports Linear Address Masking + LBRVIRT // LBR virtualization + LZCNT // LZCNT instruction + MCAOVERFLOW // MCA overflow recovery support. + MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it. + MCOMMIT // MCOMMIT instruction supported + MD_CLEAR // VERW clears CPU buffers + MMX // standard MMX + MMXEXT // SSE integer functions or AMD MMX ext + MOVBE // MOVBE instruction (big-endian) + MOVDIR64B // Move 64 Bytes as Direct Store + MOVDIRI // Move Doubleword as Direct Store + MOVSB_ZL // Fast Zero-Length MOVSB + MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD + MPX // Intel MPX (Memory Protection Extensions) + MSRIRC // Instruction Retired Counter MSR available + MSRLIST // Read/Write List of Model Specific Registers + MSR_PAGEFLUSH // Page Flush MSR available + NRIPS // Indicates support for NRIP save on VMEXIT + NX // NX (No-Execute) bit + OSXSAVE // XSAVE enabled by OS + PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption + POPCNT // POPCNT instruction + PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled + PREFETCHI // PREFETCHIT0/1 instructions + PSFD // Predictive Store Forward Disable + RDPRU // RDPRU instruction supported + RDRAND // RDRAND instruction is available + RDSEED // RDSEED instruction is available + RDTSCP // RDTSCP Instruction + RRSBA_CTRL // Restricted RSB Alternate + RTM // Restricted Transactional Memory + RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort. + SBPB // Indicates support for the Selective Branch Predictor Barrier + SERIALIZE // Serialize Instruction Execution + SEV // AMD Secure Encrypted Virtualization supported + SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host + SEV_ALTERNATIVE // AMD SEV Alternate Injection supported + SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests + SEV_ES // AMD SEV Encrypted State supported + SEV_RESTRICTED // AMD SEV Restricted Injection supported + SEV_SNP // AMD SEV Secure Nested Paging supported + SGX // Software Guard Extensions + SGXLC // Software Guard Extensions Launch Control + SHA // Intel SHA Extensions + SME // AMD Secure Memory Encryption supported + SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced + SPEC_CTRL_SSBD // Speculative Store Bypass Disable + SRBDS_CTRL // SRBDS mitigation MSR available + SRSO_MSR_FIX // Indicates that software may use MSR BP_CFG[BpSpecReduce] to mitigate SRSO. + SRSO_NO // Indicates the CPU is not subject to the SRSO vulnerability + SRSO_USER_KERNEL_NO // Indicates the CPU is not subject to the SRSO vulnerability across user/kernel boundaries + SSE // SSE functions + SSE2 // P4 SSE functions + SSE3 // Prescott SSE3 functions + SSE4 // Penryn SSE4.1 functions + SSE42 // Nehalem SSE4.2 functions + SSE4A // AMD Barcelona microarchitecture SSE4a instructions + SSSE3 // Conroe SSSE3 functions + STIBP // Single Thread Indirect Branch Predictors + STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On + STOSB_SHORT // Fast short STOSB + SUCCOR // Software uncorrectable error containment and recovery capability. + SVM // AMD Secure Virtual Machine + SVMDA // Indicates support for the SVM decode assists. + SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control + SVML // AMD SVM lock. Indicates support for SVM-Lock. + SVMNP // AMD SVM nested paging + SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter + SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold + SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions. + SYSEE // SYSENTER and SYSEXIT instructions + TBM // AMD Trailing Bit Manipulation + TDX_GUEST // Intel Trust Domain Extensions Guest + TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations + TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE. + TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX. + TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104 + TSXLDTRK // Intel TSX Suspend Load Address Tracking + VAES // Vector AES. AVX(512) versions requires additional checks. + VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits. + VMPL // AMD VM Permission Levels supported + VMSA_REGPROT // AMD VMSA Register Protection supported + VMX // Virtual Machine Extensions + VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions. + VTE // AMD Virtual Transparent Encryption supported + WAITPKG // TPAUSE, UMONITOR, UMWAIT + WBNOINVD // Write Back and Do Not Invalidate Cache + WRMSRNS // Non-Serializing Write to Model Specific Register + X87 // FPU + XGETBV1 // Supports XGETBV with ECX = 1 + XOP // Bulldozer XOP functions + XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV + XSAVEC // Supports XSAVEC and the compacted form of XRSTOR. + XSAVEOPT // XSAVEOPT available + XSAVES // Supports XSAVES/XRSTORS and IA32_XSS // ARM features: AESARM // AES instructions @@ -302,9 +315,11 @@ type CPUInfo struct { L2 int // L2 Cache (per core or shared). Will be -1 if undetected L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected } - SGX SGXSupport - maxFunc uint32 - maxExFunc uint32 + SGX SGXSupport + AMDMemEncryption AMDMemEncryptionSupport + AVX10Level uint8 + maxFunc uint32 + maxExFunc uint32 } var cpuid func(op uint32) (eax, ebx, ecx, edx uint32) @@ -1071,6 +1086,32 @@ func hasSGX(available, lc bool) (rval SGXSupport) { return } +type AMDMemEncryptionSupport struct { + Available bool + CBitPossition uint32 + NumVMPL uint32 + PhysAddrReduction uint32 + NumEntryptedGuests uint32 + MinSevNoEsAsid uint32 +} + +func hasAMDMemEncryption(available bool) (rval AMDMemEncryptionSupport) { + rval.Available = available + if !available { + return + } + + _, b, c, d := cpuidex(0x8000001f, 0) + + rval.CBitPossition = b & 0x3f + rval.PhysAddrReduction = (b >> 6) & 0x3F + rval.NumVMPL = (b >> 12) & 0xf + rval.NumEntryptedGuests = c + rval.MinSevNoEsAsid = d + + return +} + func support() flagSet { var fs flagSet mfi := maxFunctionID() @@ -1165,6 +1206,7 @@ func support() flagSet { fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ) fs.setIf(ecx&(1<<13) != 0, TME) fs.setIf(ecx&(1<<25) != 0, CLDEMOTE) + fs.setIf(ecx&(1<<23) != 0, KEYLOCKER) fs.setIf(ecx&(1<<27) != 0, MOVDIRI) fs.setIf(ecx&(1<<28) != 0, MOVDIR64B) fs.setIf(ecx&(1<<29) != 0, ENQCMD) @@ -1201,7 +1243,10 @@ func support() flagSet { // CPUID.(EAX=7, ECX=1).EDX fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8) fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT) + fs.setIf(edx1&(1<<10) != 0, AVXVNNIINT16) fs.setIf(edx1&(1<<14) != 0, PREFETCHI) + fs.setIf(edx1&(1<<19) != 0, AVX10) + fs.setIf(edx1&(1<<21) != 0, APX_F) // Only detect AVX-512 features if XGETBV is supported if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) { @@ -1252,6 +1297,19 @@ func support() flagSet { fs.setIf(edx&(1<<4) != 0, BHI_CTRL) fs.setIf(edx&(1<<5) != 0, MCDT_NO) + // Add keylocker features. + if fs.inSet(KEYLOCKER) && mfi >= 0x19 { + _, ebx, _, _ := cpuidex(0x19, 0) + fs.setIf(ebx&5 == 5, KEYLOCKERW) // Bit 0 and 2 (1+4) + } + + // Add AVX10 features. + if fs.inSet(AVX10) && mfi >= 0x24 { + _, ebx, _, _ := cpuidex(0x24, 0) + fs.setIf(ebx&(1<<16) != 0, AVX10_128) + fs.setIf(ebx&(1<<17) != 0, AVX10_256) + fs.setIf(ebx&(1<<18) != 0, AVX10_512) + } } // Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1) @@ -1394,6 +1452,29 @@ func support() flagSet { fs.setIf((a>>24)&1 == 1, VMSA_REGPROT) } + if maxExtendedFunction() >= 0x80000021 && vend == AMD { + a, _, _, _ := cpuid(0x80000021) + fs.setIf((a>>31)&1 == 1, SRSO_MSR_FIX) + fs.setIf((a>>30)&1 == 1, SRSO_USER_KERNEL_NO) + fs.setIf((a>>29)&1 == 1, SRSO_NO) + fs.setIf((a>>28)&1 == 1, IBPB_BRTYPE) + fs.setIf((a>>27)&1 == 1, SBPB) + } + + if mfi >= 0x20 { + // Microsoft has decided to purposefully hide the information + // of the guest TEE when VMs are being created using Hyper-V. + // + // This leads us to check for the Hyper-V cpuid features + // (0x4000000C), and then for the `ebx` value set. + // + // For Intel TDX, `ebx` is set as `0xbe3`, being 3 the part + // we're mostly interested about,according to: + // https://github.com/torvalds/linux/blob/d2f51b3516dade79269ff45eae2a7668ae711b25/arch/x86/include/asm/hyperv-tlfs.h#L169-L174 + _, ebx, _, _ := cpuid(0x4000000C) + fs.setIf(ebx == 0xbe3, TDX_GUEST) + } + if mfi >= 0x21 { // Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21). _, ebx, ecx, edx := cpuid(0x21) @@ -1404,6 +1485,14 @@ func support() flagSet { return fs } +func (c *CPUInfo) supportAVX10() uint8 { + if c.maxFunc >= 0x24 && c.featureSet.inSet(AVX10) { + _, ebx, _, _ := cpuidex(0x24, 0) + return uint8(ebx) + } + return 0 +} + func valAsString(values ...uint32) []byte { r := make([]byte, 4*len(values)) for i, v := range values { diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go index c946824ec..799b400c2 100644 --- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go +++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go @@ -27,10 +27,12 @@ func addInfo(c *CPUInfo, safe bool) { c.Family, c.Model, c.Stepping = familyModel() c.featureSet = support() c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC)) + c.AMDMemEncryption = hasAMDMemEncryption(c.featureSet.inSet(SME) || c.featureSet.inSet(SEV)) c.ThreadsPerCore = threadsPerCore() c.LogicalCores = logicalCores() c.PhysicalCores = physicalCores() c.VendorID, c.VendorString = vendorID() + c.AVX10Level = c.supportAVX10() c.cacheSize() c.frequencies() } diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go index 024c706af..3a2560310 100644 --- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go +++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go @@ -16,210 +16,223 @@ func _() { _ = x[AMXFP16-6] _ = x[AMXINT8-7] _ = x[AMXTILE-8] - _ = x[AVX-9] - _ = x[AVX2-10] - _ = x[AVX512BF16-11] - _ = x[AVX512BITALG-12] - _ = x[AVX512BW-13] - _ = x[AVX512CD-14] - _ = x[AVX512DQ-15] - _ = x[AVX512ER-16] - _ = x[AVX512F-17] - _ = x[AVX512FP16-18] - _ = x[AVX512IFMA-19] - _ = x[AVX512PF-20] - _ = x[AVX512VBMI-21] - _ = x[AVX512VBMI2-22] - _ = x[AVX512VL-23] - _ = x[AVX512VNNI-24] - _ = x[AVX512VP2INTERSECT-25] - _ = x[AVX512VPOPCNTDQ-26] - _ = x[AVXIFMA-27] - _ = x[AVXNECONVERT-28] - _ = x[AVXSLOW-29] - _ = x[AVXVNNI-30] - _ = x[AVXVNNIINT8-31] - _ = x[BHI_CTRL-32] - _ = x[BMI1-33] - _ = x[BMI2-34] - _ = x[CETIBT-35] - _ = x[CETSS-36] - _ = x[CLDEMOTE-37] - _ = x[CLMUL-38] - _ = x[CLZERO-39] - _ = x[CMOV-40] - _ = x[CMPCCXADD-41] - _ = x[CMPSB_SCADBS_SHORT-42] - _ = x[CMPXCHG8-43] - _ = x[CPBOOST-44] - _ = x[CPPC-45] - _ = x[CX16-46] - _ = x[EFER_LMSLE_UNS-47] - _ = x[ENQCMD-48] - _ = x[ERMS-49] - _ = x[F16C-50] - _ = x[FLUSH_L1D-51] - _ = x[FMA3-52] - _ = x[FMA4-53] - _ = x[FP128-54] - _ = x[FP256-55] - _ = x[FSRM-56] - _ = x[FXSR-57] - _ = x[FXSROPT-58] - _ = x[GFNI-59] - _ = x[HLE-60] - _ = x[HRESET-61] - _ = x[HTT-62] - _ = x[HWA-63] - _ = x[HYBRID_CPU-64] - _ = x[HYPERVISOR-65] - _ = x[IA32_ARCH_CAP-66] - _ = x[IA32_CORE_CAP-67] - _ = x[IBPB-68] - _ = x[IBRS-69] - _ = x[IBRS_PREFERRED-70] - _ = x[IBRS_PROVIDES_SMP-71] - _ = x[IBS-72] - _ = x[IBSBRNTRGT-73] - _ = x[IBSFETCHSAM-74] - _ = x[IBSFFV-75] - _ = x[IBSOPCNT-76] - _ = x[IBSOPCNTEXT-77] - _ = x[IBSOPSAM-78] - _ = x[IBSRDWROPCNT-79] - _ = x[IBSRIPINVALIDCHK-80] - _ = x[IBS_FETCH_CTLX-81] - _ = x[IBS_OPDATA4-82] - _ = x[IBS_OPFUSE-83] - _ = x[IBS_PREVENTHOST-84] - _ = x[IBS_ZEN4-85] - _ = x[IDPRED_CTRL-86] - _ = x[INT_WBINVD-87] - _ = x[INVLPGB-88] - _ = x[LAHF-89] - _ = x[LAM-90] - _ = x[LBRVIRT-91] - _ = x[LZCNT-92] - _ = x[MCAOVERFLOW-93] - _ = x[MCDT_NO-94] - _ = x[MCOMMIT-95] - _ = x[MD_CLEAR-96] - _ = x[MMX-97] - _ = x[MMXEXT-98] - _ = x[MOVBE-99] - _ = x[MOVDIR64B-100] - _ = x[MOVDIRI-101] - _ = x[MOVSB_ZL-102] - _ = x[MOVU-103] - _ = x[MPX-104] - _ = x[MSRIRC-105] - _ = x[MSRLIST-106] - _ = x[MSR_PAGEFLUSH-107] - _ = x[NRIPS-108] - _ = x[NX-109] - _ = x[OSXSAVE-110] - _ = x[PCONFIG-111] - _ = x[POPCNT-112] - _ = x[PPIN-113] - _ = x[PREFETCHI-114] - _ = x[PSFD-115] - _ = x[RDPRU-116] - _ = x[RDRAND-117] - _ = x[RDSEED-118] - _ = x[RDTSCP-119] - _ = x[RRSBA_CTRL-120] - _ = x[RTM-121] - _ = x[RTM_ALWAYS_ABORT-122] - _ = x[SERIALIZE-123] - _ = x[SEV-124] - _ = x[SEV_64BIT-125] - _ = x[SEV_ALTERNATIVE-126] - _ = x[SEV_DEBUGSWAP-127] - _ = x[SEV_ES-128] - _ = x[SEV_RESTRICTED-129] - _ = x[SEV_SNP-130] - _ = x[SGX-131] - _ = x[SGXLC-132] - _ = x[SHA-133] - _ = x[SME-134] - _ = x[SME_COHERENT-135] - _ = x[SPEC_CTRL_SSBD-136] - _ = x[SRBDS_CTRL-137] - _ = x[SSE-138] - _ = x[SSE2-139] - _ = x[SSE3-140] - _ = x[SSE4-141] - _ = x[SSE42-142] - _ = x[SSE4A-143] - _ = x[SSSE3-144] - _ = x[STIBP-145] - _ = x[STIBP_ALWAYSON-146] - _ = x[STOSB_SHORT-147] - _ = x[SUCCOR-148] - _ = x[SVM-149] - _ = x[SVMDA-150] - _ = x[SVMFBASID-151] - _ = x[SVML-152] - _ = x[SVMNP-153] - _ = x[SVMPF-154] - _ = x[SVMPFT-155] - _ = x[SYSCALL-156] - _ = x[SYSEE-157] - _ = x[TBM-158] - _ = x[TDX_GUEST-159] - _ = x[TLB_FLUSH_NESTED-160] - _ = x[TME-161] - _ = x[TOPEXT-162] - _ = x[TSCRATEMSR-163] - _ = x[TSXLDTRK-164] - _ = x[VAES-165] - _ = x[VMCBCLEAN-166] - _ = x[VMPL-167] - _ = x[VMSA_REGPROT-168] - _ = x[VMX-169] - _ = x[VPCLMULQDQ-170] - _ = x[VTE-171] - _ = x[WAITPKG-172] - _ = x[WBNOINVD-173] - _ = x[WRMSRNS-174] - _ = x[X87-175] - _ = x[XGETBV1-176] - _ = x[XOP-177] - _ = x[XSAVE-178] - _ = x[XSAVEC-179] - _ = x[XSAVEOPT-180] - _ = x[XSAVES-181] - _ = x[AESARM-182] - _ = x[ARMCPUID-183] - _ = x[ASIMD-184] - _ = x[ASIMDDP-185] - _ = x[ASIMDHP-186] - _ = x[ASIMDRDM-187] - _ = x[ATOMICS-188] - _ = x[CRC32-189] - _ = x[DCPOP-190] - _ = x[EVTSTRM-191] - _ = x[FCMA-192] - _ = x[FP-193] - _ = x[FPHP-194] - _ = x[GPA-195] - _ = x[JSCVT-196] - _ = x[LRCPC-197] - _ = x[PMULL-198] - _ = x[SHA1-199] - _ = x[SHA2-200] - _ = x[SHA3-201] - _ = x[SHA512-202] - _ = x[SM3-203] - _ = x[SM4-204] - _ = x[SVE-205] - _ = x[lastID-206] + _ = x[APX_F-9] + _ = x[AVX-10] + _ = x[AVX10-11] + _ = x[AVX10_128-12] + _ = x[AVX10_256-13] + _ = x[AVX10_512-14] + _ = x[AVX2-15] + _ = x[AVX512BF16-16] + _ = x[AVX512BITALG-17] + _ = x[AVX512BW-18] + _ = x[AVX512CD-19] + _ = x[AVX512DQ-20] + _ = x[AVX512ER-21] + _ = x[AVX512F-22] + _ = x[AVX512FP16-23] + _ = x[AVX512IFMA-24] + _ = x[AVX512PF-25] + _ = x[AVX512VBMI-26] + _ = x[AVX512VBMI2-27] + _ = x[AVX512VL-28] + _ = x[AVX512VNNI-29] + _ = x[AVX512VP2INTERSECT-30] + _ = x[AVX512VPOPCNTDQ-31] + _ = x[AVXIFMA-32] + _ = x[AVXNECONVERT-33] + _ = x[AVXSLOW-34] + _ = x[AVXVNNI-35] + _ = x[AVXVNNIINT8-36] + _ = x[AVXVNNIINT16-37] + _ = x[BHI_CTRL-38] + _ = x[BMI1-39] + _ = x[BMI2-40] + _ = x[CETIBT-41] + _ = x[CETSS-42] + _ = x[CLDEMOTE-43] + _ = x[CLMUL-44] + _ = x[CLZERO-45] + _ = x[CMOV-46] + _ = x[CMPCCXADD-47] + _ = x[CMPSB_SCADBS_SHORT-48] + _ = x[CMPXCHG8-49] + _ = x[CPBOOST-50] + _ = x[CPPC-51] + _ = x[CX16-52] + _ = x[EFER_LMSLE_UNS-53] + _ = x[ENQCMD-54] + _ = x[ERMS-55] + _ = x[F16C-56] + _ = x[FLUSH_L1D-57] + _ = x[FMA3-58] + _ = x[FMA4-59] + _ = x[FP128-60] + _ = x[FP256-61] + _ = x[FSRM-62] + _ = x[FXSR-63] + _ = x[FXSROPT-64] + _ = x[GFNI-65] + _ = x[HLE-66] + _ = x[HRESET-67] + _ = x[HTT-68] + _ = x[HWA-69] + _ = x[HYBRID_CPU-70] + _ = x[HYPERVISOR-71] + _ = x[IA32_ARCH_CAP-72] + _ = x[IA32_CORE_CAP-73] + _ = x[IBPB-74] + _ = x[IBPB_BRTYPE-75] + _ = x[IBRS-76] + _ = x[IBRS_PREFERRED-77] + _ = x[IBRS_PROVIDES_SMP-78] + _ = x[IBS-79] + _ = x[IBSBRNTRGT-80] + _ = x[IBSFETCHSAM-81] + _ = x[IBSFFV-82] + _ = x[IBSOPCNT-83] + _ = x[IBSOPCNTEXT-84] + _ = x[IBSOPSAM-85] + _ = x[IBSRDWROPCNT-86] + _ = x[IBSRIPINVALIDCHK-87] + _ = x[IBS_FETCH_CTLX-88] + _ = x[IBS_OPDATA4-89] + _ = x[IBS_OPFUSE-90] + _ = x[IBS_PREVENTHOST-91] + _ = x[IBS_ZEN4-92] + _ = x[IDPRED_CTRL-93] + _ = x[INT_WBINVD-94] + _ = x[INVLPGB-95] + _ = x[KEYLOCKER-96] + _ = x[KEYLOCKERW-97] + _ = x[LAHF-98] + _ = x[LAM-99] + _ = x[LBRVIRT-100] + _ = x[LZCNT-101] + _ = x[MCAOVERFLOW-102] + _ = x[MCDT_NO-103] + _ = x[MCOMMIT-104] + _ = x[MD_CLEAR-105] + _ = x[MMX-106] + _ = x[MMXEXT-107] + _ = x[MOVBE-108] + _ = x[MOVDIR64B-109] + _ = x[MOVDIRI-110] + _ = x[MOVSB_ZL-111] + _ = x[MOVU-112] + _ = x[MPX-113] + _ = x[MSRIRC-114] + _ = x[MSRLIST-115] + _ = x[MSR_PAGEFLUSH-116] + _ = x[NRIPS-117] + _ = x[NX-118] + _ = x[OSXSAVE-119] + _ = x[PCONFIG-120] + _ = x[POPCNT-121] + _ = x[PPIN-122] + _ = x[PREFETCHI-123] + _ = x[PSFD-124] + _ = x[RDPRU-125] + _ = x[RDRAND-126] + _ = x[RDSEED-127] + _ = x[RDTSCP-128] + _ = x[RRSBA_CTRL-129] + _ = x[RTM-130] + _ = x[RTM_ALWAYS_ABORT-131] + _ = x[SBPB-132] + _ = x[SERIALIZE-133] + _ = x[SEV-134] + _ = x[SEV_64BIT-135] + _ = x[SEV_ALTERNATIVE-136] + _ = x[SEV_DEBUGSWAP-137] + _ = x[SEV_ES-138] + _ = x[SEV_RESTRICTED-139] + _ = x[SEV_SNP-140] + _ = x[SGX-141] + _ = x[SGXLC-142] + _ = x[SHA-143] + _ = x[SME-144] + _ = x[SME_COHERENT-145] + _ = x[SPEC_CTRL_SSBD-146] + _ = x[SRBDS_CTRL-147] + _ = x[SRSO_MSR_FIX-148] + _ = x[SRSO_NO-149] + _ = x[SRSO_USER_KERNEL_NO-150] + _ = x[SSE-151] + _ = x[SSE2-152] + _ = x[SSE3-153] + _ = x[SSE4-154] + _ = x[SSE42-155] + _ = x[SSE4A-156] + _ = x[SSSE3-157] + _ = x[STIBP-158] + _ = x[STIBP_ALWAYSON-159] + _ = x[STOSB_SHORT-160] + _ = x[SUCCOR-161] + _ = x[SVM-162] + _ = x[SVMDA-163] + _ = x[SVMFBASID-164] + _ = x[SVML-165] + _ = x[SVMNP-166] + _ = x[SVMPF-167] + _ = x[SVMPFT-168] + _ = x[SYSCALL-169] + _ = x[SYSEE-170] + _ = x[TBM-171] + _ = x[TDX_GUEST-172] + _ = x[TLB_FLUSH_NESTED-173] + _ = x[TME-174] + _ = x[TOPEXT-175] + _ = x[TSCRATEMSR-176] + _ = x[TSXLDTRK-177] + _ = x[VAES-178] + _ = x[VMCBCLEAN-179] + _ = x[VMPL-180] + _ = x[VMSA_REGPROT-181] + _ = x[VMX-182] + _ = x[VPCLMULQDQ-183] + _ = x[VTE-184] + _ = x[WAITPKG-185] + _ = x[WBNOINVD-186] + _ = x[WRMSRNS-187] + _ = x[X87-188] + _ = x[XGETBV1-189] + _ = x[XOP-190] + _ = x[XSAVE-191] + _ = x[XSAVEC-192] + _ = x[XSAVEOPT-193] + _ = x[XSAVES-194] + _ = x[AESARM-195] + _ = x[ARMCPUID-196] + _ = x[ASIMD-197] + _ = x[ASIMDDP-198] + _ = x[ASIMDHP-199] + _ = x[ASIMDRDM-200] + _ = x[ATOMICS-201] + _ = x[CRC32-202] + _ = x[DCPOP-203] + _ = x[EVTSTRM-204] + _ = x[FCMA-205] + _ = x[FP-206] + _ = x[FPHP-207] + _ = x[GPA-208] + _ = x[JSCVT-209] + _ = x[LRCPC-210] + _ = x[PMULL-211] + _ = x[SHA1-212] + _ = x[SHA2-213] + _ = x[SHA3-214] + _ = x[SHA512-215] + _ = x[SM3-216] + _ = x[SM4-217] + _ = x[SVE-218] + _ = x[lastID-219] _ = x[firstID-0] } -const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" +const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID" -var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465} +var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 323, 331, 335, 339, 345, 350, 358, 363, 369, 373, 382, 400, 408, 415, 419, 423, 437, 443, 447, 451, 460, 464, 468, 473, 478, 482, 486, 493, 497, 500, 506, 509, 512, 522, 532, 545, 558, 562, 573, 577, 591, 608, 611, 621, 632, 638, 646, 657, 665, 677, 693, 707, 718, 728, 743, 751, 762, 772, 779, 788, 798, 802, 805, 812, 817, 828, 835, 842, 850, 853, 859, 864, 873, 880, 888, 892, 895, 901, 908, 921, 926, 928, 935, 942, 948, 952, 961, 965, 970, 976, 982, 988, 998, 1001, 1017, 1021, 1030, 1033, 1042, 1057, 1070, 1076, 1090, 1097, 1100, 1105, 1108, 1111, 1123, 1137, 1147, 1159, 1166, 1185, 1188, 1192, 1196, 1200, 1205, 1210, 1215, 1220, 1234, 1245, 1251, 1254, 1259, 1268, 1272, 1277, 1282, 1288, 1295, 1300, 1303, 1312, 1328, 1331, 1337, 1347, 1355, 1359, 1368, 1372, 1384, 1387, 1397, 1400, 1407, 1415, 1422, 1425, 1432, 1435, 1440, 1446, 1454, 1460, 1466, 1474, 1479, 1486, 1493, 1501, 1508, 1513, 1518, 1525, 1529, 1531, 1535, 1538, 1543, 1548, 1553, 1557, 1561, 1565, 1571, 1574, 1577, 1580, 1586} func (i FeatureID) String() string { if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) { |
