aboutsummaryrefslogtreecommitdiffstats
path: root/vendor/github.com/klauspost/cpuid
diff options
context:
space:
mode:
authorAleksandr Nogikh <nogikh@google.com>2025-01-02 11:58:29 +0100
committerAleksandr Nogikh <nogikh@google.com>2025-01-22 13:17:53 +0000
commit7512e6e7738143bd302d9b20cb1fd0d1d7af9643 (patch)
tree67988d580d111bacbd009acfc0057f89aafa6522 /vendor/github.com/klauspost/cpuid
parent44f2ad31190603135f4ac758273f26111ca6003c (diff)
vendor: fetch the dependencies
Diffstat (limited to 'vendor/github.com/klauspost/cpuid')
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/README.md15
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/cpuid.go459
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/detect_x86.go2
-rw-r--r--vendor/github.com/klauspost/cpuid/v2/featureid_string.go413
4 files changed, 499 insertions, 390 deletions
diff --git a/vendor/github.com/klauspost/cpuid/v2/README.md b/vendor/github.com/klauspost/cpuid/v2/README.md
index accd7abaf..21508edbd 100644
--- a/vendor/github.com/klauspost/cpuid/v2/README.md
+++ b/vendor/github.com/klauspost/cpuid/v2/README.md
@@ -9,10 +9,7 @@ You can access the CPU information by accessing the shared CPU variable of the c
Package home: https://github.com/klauspost/cpuid
[![PkgGoDev](https://pkg.go.dev/badge/github.com/klauspost/cpuid)](https://pkg.go.dev/github.com/klauspost/cpuid/v2)
-[![Build Status][3]][4]
-
-[3]: https://travis-ci.org/klauspost/cpuid.svg?branch=master
-[4]: https://travis-ci.org/klauspost/cpuid
+[![Go](https://github.com/klauspost/cpuid/actions/workflows/go.yml/badge.svg)](https://github.com/klauspost/cpuid/actions/workflows/go.yml)
## installing
@@ -285,7 +282,12 @@ Exit Code 1
| AMXINT8 | Tile computational operations on 8-bit integers |
| AMXFP16 | Tile computational operations on FP16 numbers |
| AMXTILE | Tile architecture |
+| APX_F | Intel APX |
| AVX | AVX functions |
+| AVX10 | If set the Intel AVX10 Converged Vector ISA is supported |
+| AVX10_128 | If set indicates that AVX10 128-bit vector support is present |
+| AVX10_256 | If set indicates that AVX10 256-bit vector support is present |
+| AVX10_512 | If set indicates that AVX10 512-bit vector support is present |
| AVX2 | AVX2 functions |
| AVX512BF16 | AVX-512 BFLOAT16 Instructions |
| AVX512BITALG | AVX-512 Bit Algorithms |
@@ -308,6 +310,7 @@ Exit Code 1
| AVXSLOW | Indicates the CPU performs 2 128 bit operations instead of one |
| AVXVNNI | AVX (VEX encoded) VNNI neural network instructions |
| AVXVNNIINT8 | AVX-VNNI-INT8 instructions |
+| AVXVNNIINT16 | AVX-VNNI-INT16 instructions |
| BHI_CTRL | Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598 |
| BMI1 | Bit Manipulation Instruction Set 1 |
| BMI2 | Bit Manipulation Instruction Set 2 |
@@ -365,6 +368,8 @@ Exit Code 1
| IDPRED_CTRL | IPRED_DIS |
| INT_WBINVD | WBINVD/WBNOINVD are interruptible. |
| INVLPGB | NVLPGB and TLBSYNC instruction supported |
+| KEYLOCKER | Key locker |
+| KEYLOCKERW | Key locker wide |
| LAHF | LAHF/SAHF in long mode |
| LAM | If set, CPU supports Linear Address Masking |
| LBRVIRT | LBR virtualization |
@@ -380,7 +385,7 @@ Exit Code 1
| MOVDIRI | Move Doubleword as Direct Store |
| MOVSB_ZL | Fast Zero-Length MOVSB |
| MPX | Intel MPX (Memory Protection Extensions) |
-| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
+| MOVU | MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD |
| MSRIRC | Instruction Retired Counter MSR available |
| MSRLIST | Read/Write List of Model Specific Registers |
| MSR_PAGEFLUSH | Page Flush MSR available |
diff --git a/vendor/github.com/klauspost/cpuid/v2/cpuid.go b/vendor/github.com/klauspost/cpuid/v2/cpuid.go
index d015c744e..53bc18ca7 100644
--- a/vendor/github.com/klauspost/cpuid/v2/cpuid.go
+++ b/vendor/github.com/klauspost/cpuid/v2/cpuid.go
@@ -67,188 +67,201 @@ const (
// Keep index -1 as unknown
UNKNOWN = -1
- // Add features
- ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions)
- AESNI // Advanced Encryption Standard New Instructions
- AMD3DNOW // AMD 3DNOW
- AMD3DNOWEXT // AMD 3DNowExt
- AMXBF16 // Tile computational operations on BFLOAT16 numbers
- AMXFP16 // Tile computational operations on FP16 numbers
- AMXINT8 // Tile computational operations on 8-bit integers
- AMXTILE // Tile architecture
- AVX // AVX functions
- AVX2 // AVX2 functions
- AVX512BF16 // AVX-512 BFLOAT16 Instructions
- AVX512BITALG // AVX-512 Bit Algorithms
- AVX512BW // AVX-512 Byte and Word Instructions
- AVX512CD // AVX-512 Conflict Detection Instructions
- AVX512DQ // AVX-512 Doubleword and Quadword Instructions
- AVX512ER // AVX-512 Exponential and Reciprocal Instructions
- AVX512F // AVX-512 Foundation
- AVX512FP16 // AVX-512 FP16 Instructions
- AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions
- AVX512PF // AVX-512 Prefetch Instructions
- AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions
- AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2
- AVX512VL // AVX-512 Vector Length Extensions
- AVX512VNNI // AVX-512 Vector Neural Network Instructions
- AVX512VP2INTERSECT // AVX-512 Intersect for D/Q
- AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword
- AVXIFMA // AVX-IFMA instructions
- AVXNECONVERT // AVX-NE-CONVERT instructions
- AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one
- AVXVNNI // AVX (VEX encoded) VNNI neural network instructions
- AVXVNNIINT8 // AVX-VNNI-INT8 instructions
- BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598
- BMI1 // Bit Manipulation Instruction Set 1
- BMI2 // Bit Manipulation Instruction Set 2
- CETIBT // Intel CET Indirect Branch Tracking
- CETSS // Intel CET Shadow Stack
- CLDEMOTE // Cache Line Demote
- CLMUL // Carry-less Multiplication
- CLZERO // CLZERO instruction supported
- CMOV // i686 CMOV
- CMPCCXADD // CMPCCXADD instructions
- CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB
- CMPXCHG8 // CMPXCHG8 instruction
- CPBOOST // Core Performance Boost
- CPPC // AMD: Collaborative Processor Performance Control
- CX16 // CMPXCHG16B Instruction
- EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ
- ENQCMD // Enqueue Command
- ERMS // Enhanced REP MOVSB/STOSB
- F16C // Half-precision floating-point conversion
- FLUSH_L1D // Flush L1D cache
- FMA3 // Intel FMA 3. Does not imply AVX.
- FMA4 // Bulldozer FMA4 functions
- FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide
- FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide
- FSRM // Fast Short Rep Mov
- FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9
- FXSROPT // FXSAVE/FXRSTOR optimizations
- GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage.
- HLE // Hardware Lock Elision
- HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR
- HTT // Hyperthreading (enabled)
- HWA // Hardware assert supported. Indicates support for MSRC001_10
- HYBRID_CPU // This part has CPUs of more than one type.
- HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors
- IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel)
- IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR
- IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)
- IBRS // AMD: Indirect Branch Restricted Speculation
- IBRS_PREFERRED // AMD: IBRS is preferred over software solution
- IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection
- IBS // Instruction Based Sampling (AMD)
- IBSBRNTRGT // Instruction Based Sampling Feature (AMD)
- IBSFETCHSAM // Instruction Based Sampling Feature (AMD)
- IBSFFV // Instruction Based Sampling Feature (AMD)
- IBSOPCNT // Instruction Based Sampling Feature (AMD)
- IBSOPCNTEXT // Instruction Based Sampling Feature (AMD)
- IBSOPSAM // Instruction Based Sampling Feature (AMD)
- IBSRDWROPCNT // Instruction Based Sampling Feature (AMD)
- IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD)
- IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported
- IBS_OPDATA4 // AMD: IBS op data 4 MSR supported
- IBS_OPFUSE // AMD: Indicates support for IbsOpFuse
- IBS_PREVENTHOST // Disallowing IBS use by the host supported
- IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4
- IDPRED_CTRL // IPRED_DIS
- INT_WBINVD // WBINVD/WBNOINVD are interruptible.
- INVLPGB // NVLPGB and TLBSYNC instruction supported
- LAHF // LAHF/SAHF in long mode
- LAM // If set, CPU supports Linear Address Masking
- LBRVIRT // LBR virtualization
- LZCNT // LZCNT instruction
- MCAOVERFLOW // MCA overflow recovery support.
- MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it.
- MCOMMIT // MCOMMIT instruction supported
- MD_CLEAR // VERW clears CPU buffers
- MMX // standard MMX
- MMXEXT // SSE integer functions or AMD MMX ext
- MOVBE // MOVBE instruction (big-endian)
- MOVDIR64B // Move 64 Bytes as Direct Store
- MOVDIRI // Move Doubleword as Direct Store
- MOVSB_ZL // Fast Zero-Length MOVSB
- MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD
- MPX // Intel MPX (Memory Protection Extensions)
- MSRIRC // Instruction Retired Counter MSR available
- MSRLIST // Read/Write List of Model Specific Registers
- MSR_PAGEFLUSH // Page Flush MSR available
- NRIPS // Indicates support for NRIP save on VMEXIT
- NX // NX (No-Execute) bit
- OSXSAVE // XSAVE enabled by OS
- PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption
- POPCNT // POPCNT instruction
- PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled
- PREFETCHI // PREFETCHIT0/1 instructions
- PSFD // Predictive Store Forward Disable
- RDPRU // RDPRU instruction supported
- RDRAND // RDRAND instruction is available
- RDSEED // RDSEED instruction is available
- RDTSCP // RDTSCP Instruction
- RRSBA_CTRL // Restricted RSB Alternate
- RTM // Restricted Transactional Memory
- RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort.
- SERIALIZE // Serialize Instruction Execution
- SEV // AMD Secure Encrypted Virtualization supported
- SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host
- SEV_ALTERNATIVE // AMD SEV Alternate Injection supported
- SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests
- SEV_ES // AMD SEV Encrypted State supported
- SEV_RESTRICTED // AMD SEV Restricted Injection supported
- SEV_SNP // AMD SEV Secure Nested Paging supported
- SGX // Software Guard Extensions
- SGXLC // Software Guard Extensions Launch Control
- SHA // Intel SHA Extensions
- SME // AMD Secure Memory Encryption supported
- SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced
- SPEC_CTRL_SSBD // Speculative Store Bypass Disable
- SRBDS_CTRL // SRBDS mitigation MSR available
- SSE // SSE functions
- SSE2 // P4 SSE functions
- SSE3 // Prescott SSE3 functions
- SSE4 // Penryn SSE4.1 functions
- SSE42 // Nehalem SSE4.2 functions
- SSE4A // AMD Barcelona microarchitecture SSE4a instructions
- SSSE3 // Conroe SSSE3 functions
- STIBP // Single Thread Indirect Branch Predictors
- STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On
- STOSB_SHORT // Fast short STOSB
- SUCCOR // Software uncorrectable error containment and recovery capability.
- SVM // AMD Secure Virtual Machine
- SVMDA // Indicates support for the SVM decode assists.
- SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control
- SVML // AMD SVM lock. Indicates support for SVM-Lock.
- SVMNP // AMD SVM nested paging
- SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter
- SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold
- SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
- SYSEE // SYSENTER and SYSEXIT instructions
- TBM // AMD Trailing Bit Manipulation
- TDX_GUEST // Intel Trust Domain Extensions Guest
- TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
- TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
- TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
- TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104
- TSXLDTRK // Intel TSX Suspend Load Address Tracking
- VAES // Vector AES. AVX(512) versions requires additional checks.
- VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits.
- VMPL // AMD VM Permission Levels supported
- VMSA_REGPROT // AMD VMSA Register Protection supported
- VMX // Virtual Machine Extensions
- VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions.
- VTE // AMD Virtual Transparent Encryption supported
- WAITPKG // TPAUSE, UMONITOR, UMWAIT
- WBNOINVD // Write Back and Do Not Invalidate Cache
- WRMSRNS // Non-Serializing Write to Model Specific Register
- X87 // FPU
- XGETBV1 // Supports XGETBV with ECX = 1
- XOP // Bulldozer XOP functions
- XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV
- XSAVEC // Supports XSAVEC and the compacted form of XRSTOR.
- XSAVEOPT // XSAVEOPT available
- XSAVES // Supports XSAVES/XRSTORS and IA32_XSS
+ // x86 features
+ ADX FeatureID = iota // Intel ADX (Multi-Precision Add-Carry Instruction Extensions)
+ AESNI // Advanced Encryption Standard New Instructions
+ AMD3DNOW // AMD 3DNOW
+ AMD3DNOWEXT // AMD 3DNowExt
+ AMXBF16 // Tile computational operations on BFLOAT16 numbers
+ AMXFP16 // Tile computational operations on FP16 numbers
+ AMXINT8 // Tile computational operations on 8-bit integers
+ AMXTILE // Tile architecture
+ APX_F // Intel APX
+ AVX // AVX functions
+ AVX10 // If set the Intel AVX10 Converged Vector ISA is supported
+ AVX10_128 // If set indicates that AVX10 128-bit vector support is present
+ AVX10_256 // If set indicates that AVX10 256-bit vector support is present
+ AVX10_512 // If set indicates that AVX10 512-bit vector support is present
+ AVX2 // AVX2 functions
+ AVX512BF16 // AVX-512 BFLOAT16 Instructions
+ AVX512BITALG // AVX-512 Bit Algorithms
+ AVX512BW // AVX-512 Byte and Word Instructions
+ AVX512CD // AVX-512 Conflict Detection Instructions
+ AVX512DQ // AVX-512 Doubleword and Quadword Instructions
+ AVX512ER // AVX-512 Exponential and Reciprocal Instructions
+ AVX512F // AVX-512 Foundation
+ AVX512FP16 // AVX-512 FP16 Instructions
+ AVX512IFMA // AVX-512 Integer Fused Multiply-Add Instructions
+ AVX512PF // AVX-512 Prefetch Instructions
+ AVX512VBMI // AVX-512 Vector Bit Manipulation Instructions
+ AVX512VBMI2 // AVX-512 Vector Bit Manipulation Instructions, Version 2
+ AVX512VL // AVX-512 Vector Length Extensions
+ AVX512VNNI // AVX-512 Vector Neural Network Instructions
+ AVX512VP2INTERSECT // AVX-512 Intersect for D/Q
+ AVX512VPOPCNTDQ // AVX-512 Vector Population Count Doubleword and Quadword
+ AVXIFMA // AVX-IFMA instructions
+ AVXNECONVERT // AVX-NE-CONVERT instructions
+ AVXSLOW // Indicates the CPU performs 2 128 bit operations instead of one
+ AVXVNNI // AVX (VEX encoded) VNNI neural network instructions
+ AVXVNNIINT8 // AVX-VNNI-INT8 instructions
+ AVXVNNIINT16 // AVX-VNNI-INT16 instructions
+ BHI_CTRL // Branch History Injection and Intra-mode Branch Target Injection / CVE-2022-0001, CVE-2022-0002 / INTEL-SA-00598
+ BMI1 // Bit Manipulation Instruction Set 1
+ BMI2 // Bit Manipulation Instruction Set 2
+ CETIBT // Intel CET Indirect Branch Tracking
+ CETSS // Intel CET Shadow Stack
+ CLDEMOTE // Cache Line Demote
+ CLMUL // Carry-less Multiplication
+ CLZERO // CLZERO instruction supported
+ CMOV // i686 CMOV
+ CMPCCXADD // CMPCCXADD instructions
+ CMPSB_SCADBS_SHORT // Fast short CMPSB and SCASB
+ CMPXCHG8 // CMPXCHG8 instruction
+ CPBOOST // Core Performance Boost
+ CPPC // AMD: Collaborative Processor Performance Control
+ CX16 // CMPXCHG16B Instruction
+ EFER_LMSLE_UNS // AMD: =Core::X86::Msr::EFER[LMSLE] is not supported, and MBZ
+ ENQCMD // Enqueue Command
+ ERMS // Enhanced REP MOVSB/STOSB
+ F16C // Half-precision floating-point conversion
+ FLUSH_L1D // Flush L1D cache
+ FMA3 // Intel FMA 3. Does not imply AVX.
+ FMA4 // Bulldozer FMA4 functions
+ FP128 // AMD: When set, the internal FP/SIMD execution datapath is no more than 128-bits wide
+ FP256 // AMD: When set, the internal FP/SIMD execution datapath is no more than 256-bits wide
+ FSRM // Fast Short Rep Mov
+ FXSR // FXSAVE, FXRESTOR instructions, CR4 bit 9
+ FXSROPT // FXSAVE/FXRSTOR optimizations
+ GFNI // Galois Field New Instructions. May require other features (AVX, AVX512VL,AVX512F) based on usage.
+ HLE // Hardware Lock Elision
+ HRESET // If set CPU supports history reset and the IA32_HRESET_ENABLE MSR
+ HTT // Hyperthreading (enabled)
+ HWA // Hardware assert supported. Indicates support for MSRC001_10
+ HYBRID_CPU // This part has CPUs of more than one type.
+ HYPERVISOR // This bit has been reserved by Intel & AMD for use by hypervisors
+ IA32_ARCH_CAP // IA32_ARCH_CAPABILITIES MSR (Intel)
+ IA32_CORE_CAP // IA32_CORE_CAPABILITIES MSR
+ IBPB // Indirect Branch Restricted Speculation (IBRS) and Indirect Branch Predictor Barrier (IBPB)
+ IBPB_BRTYPE // Indicates that MSR 49h (PRED_CMD) bit 0 (IBPB) flushes all branch type predictions from the CPU branch predictor
+ IBRS // AMD: Indirect Branch Restricted Speculation
+ IBRS_PREFERRED // AMD: IBRS is preferred over software solution
+ IBRS_PROVIDES_SMP // AMD: IBRS provides Same Mode Protection
+ IBS // Instruction Based Sampling (AMD)
+ IBSBRNTRGT // Instruction Based Sampling Feature (AMD)
+ IBSFETCHSAM // Instruction Based Sampling Feature (AMD)
+ IBSFFV // Instruction Based Sampling Feature (AMD)
+ IBSOPCNT // Instruction Based Sampling Feature (AMD)
+ IBSOPCNTEXT // Instruction Based Sampling Feature (AMD)
+ IBSOPSAM // Instruction Based Sampling Feature (AMD)
+ IBSRDWROPCNT // Instruction Based Sampling Feature (AMD)
+ IBSRIPINVALIDCHK // Instruction Based Sampling Feature (AMD)
+ IBS_FETCH_CTLX // AMD: IBS fetch control extended MSR supported
+ IBS_OPDATA4 // AMD: IBS op data 4 MSR supported
+ IBS_OPFUSE // AMD: Indicates support for IbsOpFuse
+ IBS_PREVENTHOST // Disallowing IBS use by the host supported
+ IBS_ZEN4 // AMD: Fetch and Op IBS support IBS extensions added with Zen4
+ IDPRED_CTRL // IPRED_DIS
+ INT_WBINVD // WBINVD/WBNOINVD are interruptible.
+ INVLPGB // NVLPGB and TLBSYNC instruction supported
+ KEYLOCKER // Key locker
+ KEYLOCKERW // Key locker wide
+ LAHF // LAHF/SAHF in long mode
+ LAM // If set, CPU supports Linear Address Masking
+ LBRVIRT // LBR virtualization
+ LZCNT // LZCNT instruction
+ MCAOVERFLOW // MCA overflow recovery support.
+ MCDT_NO // Processor do not exhibit MXCSR Configuration Dependent Timing behavior and do not need to mitigate it.
+ MCOMMIT // MCOMMIT instruction supported
+ MD_CLEAR // VERW clears CPU buffers
+ MMX // standard MMX
+ MMXEXT // SSE integer functions or AMD MMX ext
+ MOVBE // MOVBE instruction (big-endian)
+ MOVDIR64B // Move 64 Bytes as Direct Store
+ MOVDIRI // Move Doubleword as Direct Store
+ MOVSB_ZL // Fast Zero-Length MOVSB
+ MOVU // AMD: MOVU SSE instructions are more efficient and should be preferred to SSE MOVL/MOVH. MOVUPS is more efficient than MOVLPS/MOVHPS. MOVUPD is more efficient than MOVLPD/MOVHPD
+ MPX // Intel MPX (Memory Protection Extensions)
+ MSRIRC // Instruction Retired Counter MSR available
+ MSRLIST // Read/Write List of Model Specific Registers
+ MSR_PAGEFLUSH // Page Flush MSR available
+ NRIPS // Indicates support for NRIP save on VMEXIT
+ NX // NX (No-Execute) bit
+ OSXSAVE // XSAVE enabled by OS
+ PCONFIG // PCONFIG for Intel Multi-Key Total Memory Encryption
+ POPCNT // POPCNT instruction
+ PPIN // AMD: Protected Processor Inventory Number support. Indicates that Protected Processor Inventory Number (PPIN) capability can be enabled
+ PREFETCHI // PREFETCHIT0/1 instructions
+ PSFD // Predictive Store Forward Disable
+ RDPRU // RDPRU instruction supported
+ RDRAND // RDRAND instruction is available
+ RDSEED // RDSEED instruction is available
+ RDTSCP // RDTSCP Instruction
+ RRSBA_CTRL // Restricted RSB Alternate
+ RTM // Restricted Transactional Memory
+ RTM_ALWAYS_ABORT // Indicates that the loaded microcode is forcing RTM abort.
+ SBPB // Indicates support for the Selective Branch Predictor Barrier
+ SERIALIZE // Serialize Instruction Execution
+ SEV // AMD Secure Encrypted Virtualization supported
+ SEV_64BIT // AMD SEV guest execution only allowed from a 64-bit host
+ SEV_ALTERNATIVE // AMD SEV Alternate Injection supported
+ SEV_DEBUGSWAP // Full debug state swap supported for SEV-ES guests
+ SEV_ES // AMD SEV Encrypted State supported
+ SEV_RESTRICTED // AMD SEV Restricted Injection supported
+ SEV_SNP // AMD SEV Secure Nested Paging supported
+ SGX // Software Guard Extensions
+ SGXLC // Software Guard Extensions Launch Control
+ SHA // Intel SHA Extensions
+ SME // AMD Secure Memory Encryption supported
+ SME_COHERENT // AMD Hardware cache coherency across encryption domains enforced
+ SPEC_CTRL_SSBD // Speculative Store Bypass Disable
+ SRBDS_CTRL // SRBDS mitigation MSR available
+ SRSO_MSR_FIX // Indicates that software may use MSR BP_CFG[BpSpecReduce] to mitigate SRSO.
+ SRSO_NO // Indicates the CPU is not subject to the SRSO vulnerability
+ SRSO_USER_KERNEL_NO // Indicates the CPU is not subject to the SRSO vulnerability across user/kernel boundaries
+ SSE // SSE functions
+ SSE2 // P4 SSE functions
+ SSE3 // Prescott SSE3 functions
+ SSE4 // Penryn SSE4.1 functions
+ SSE42 // Nehalem SSE4.2 functions
+ SSE4A // AMD Barcelona microarchitecture SSE4a instructions
+ SSSE3 // Conroe SSSE3 functions
+ STIBP // Single Thread Indirect Branch Predictors
+ STIBP_ALWAYSON // AMD: Single Thread Indirect Branch Prediction Mode has Enhanced Performance and may be left Always On
+ STOSB_SHORT // Fast short STOSB
+ SUCCOR // Software uncorrectable error containment and recovery capability.
+ SVM // AMD Secure Virtual Machine
+ SVMDA // Indicates support for the SVM decode assists.
+ SVMFBASID // SVM, Indicates that TLB flush events, including CR3 writes and CR4.PGE toggles, flush only the current ASID's TLB entries. Also indicates support for the extended VMCBTLB_Control
+ SVML // AMD SVM lock. Indicates support for SVM-Lock.
+ SVMNP // AMD SVM nested paging
+ SVMPF // SVM pause intercept filter. Indicates support for the pause intercept filter
+ SVMPFT // SVM PAUSE filter threshold. Indicates support for the PAUSE filter cycle count threshold
+ SYSCALL // System-Call Extension (SCE): SYSCALL and SYSRET instructions.
+ SYSEE // SYSENTER and SYSEXIT instructions
+ TBM // AMD Trailing Bit Manipulation
+ TDX_GUEST // Intel Trust Domain Extensions Guest
+ TLB_FLUSH_NESTED // AMD: Flushing includes all the nested translations for guest translations
+ TME // Intel Total Memory Encryption. The following MSRs are supported: IA32_TME_CAPABILITY, IA32_TME_ACTIVATE, IA32_TME_EXCLUDE_MASK, and IA32_TME_EXCLUDE_BASE.
+ TOPEXT // TopologyExtensions: topology extensions support. Indicates support for CPUID Fn8000_001D_EAX_x[N:0]-CPUID Fn8000_001E_EDX.
+ TSCRATEMSR // MSR based TSC rate control. Indicates support for MSR TSC ratio MSRC000_0104
+ TSXLDTRK // Intel TSX Suspend Load Address Tracking
+ VAES // Vector AES. AVX(512) versions requires additional checks.
+ VMCBCLEAN // VMCB clean bits. Indicates support for VMCB clean bits.
+ VMPL // AMD VM Permission Levels supported
+ VMSA_REGPROT // AMD VMSA Register Protection supported
+ VMX // Virtual Machine Extensions
+ VPCLMULQDQ // Carry-Less Multiplication Quadword. Requires AVX for 3 register versions.
+ VTE // AMD Virtual Transparent Encryption supported
+ WAITPKG // TPAUSE, UMONITOR, UMWAIT
+ WBNOINVD // Write Back and Do Not Invalidate Cache
+ WRMSRNS // Non-Serializing Write to Model Specific Register
+ X87 // FPU
+ XGETBV1 // Supports XGETBV with ECX = 1
+ XOP // Bulldozer XOP functions
+ XSAVE // XSAVE, XRESTOR, XSETBV, XGETBV
+ XSAVEC // Supports XSAVEC and the compacted form of XRSTOR.
+ XSAVEOPT // XSAVEOPT available
+ XSAVES // Supports XSAVES/XRSTORS and IA32_XSS
// ARM features:
AESARM // AES instructions
@@ -302,9 +315,11 @@ type CPUInfo struct {
L2 int // L2 Cache (per core or shared). Will be -1 if undetected
L3 int // L3 Cache (per core, per ccx or shared). Will be -1 if undetected
}
- SGX SGXSupport
- maxFunc uint32
- maxExFunc uint32
+ SGX SGXSupport
+ AMDMemEncryption AMDMemEncryptionSupport
+ AVX10Level uint8
+ maxFunc uint32
+ maxExFunc uint32
}
var cpuid func(op uint32) (eax, ebx, ecx, edx uint32)
@@ -1071,6 +1086,32 @@ func hasSGX(available, lc bool) (rval SGXSupport) {
return
}
+type AMDMemEncryptionSupport struct {
+ Available bool
+ CBitPossition uint32
+ NumVMPL uint32
+ PhysAddrReduction uint32
+ NumEntryptedGuests uint32
+ MinSevNoEsAsid uint32
+}
+
+func hasAMDMemEncryption(available bool) (rval AMDMemEncryptionSupport) {
+ rval.Available = available
+ if !available {
+ return
+ }
+
+ _, b, c, d := cpuidex(0x8000001f, 0)
+
+ rval.CBitPossition = b & 0x3f
+ rval.PhysAddrReduction = (b >> 6) & 0x3F
+ rval.NumVMPL = (b >> 12) & 0xf
+ rval.NumEntryptedGuests = c
+ rval.MinSevNoEsAsid = d
+
+ return
+}
+
func support() flagSet {
var fs flagSet
mfi := maxFunctionID()
@@ -1165,6 +1206,7 @@ func support() flagSet {
fs.setIf(ecx&(1<<10) != 0, VPCLMULQDQ)
fs.setIf(ecx&(1<<13) != 0, TME)
fs.setIf(ecx&(1<<25) != 0, CLDEMOTE)
+ fs.setIf(ecx&(1<<23) != 0, KEYLOCKER)
fs.setIf(ecx&(1<<27) != 0, MOVDIRI)
fs.setIf(ecx&(1<<28) != 0, MOVDIR64B)
fs.setIf(ecx&(1<<29) != 0, ENQCMD)
@@ -1201,7 +1243,10 @@ func support() flagSet {
// CPUID.(EAX=7, ECX=1).EDX
fs.setIf(edx1&(1<<4) != 0, AVXVNNIINT8)
fs.setIf(edx1&(1<<5) != 0, AVXNECONVERT)
+ fs.setIf(edx1&(1<<10) != 0, AVXVNNIINT16)
fs.setIf(edx1&(1<<14) != 0, PREFETCHI)
+ fs.setIf(edx1&(1<<19) != 0, AVX10)
+ fs.setIf(edx1&(1<<21) != 0, APX_F)
// Only detect AVX-512 features if XGETBV is supported
if c&((1<<26)|(1<<27)) == (1<<26)|(1<<27) {
@@ -1252,6 +1297,19 @@ func support() flagSet {
fs.setIf(edx&(1<<4) != 0, BHI_CTRL)
fs.setIf(edx&(1<<5) != 0, MCDT_NO)
+ // Add keylocker features.
+ if fs.inSet(KEYLOCKER) && mfi >= 0x19 {
+ _, ebx, _, _ := cpuidex(0x19, 0)
+ fs.setIf(ebx&5 == 5, KEYLOCKERW) // Bit 0 and 2 (1+4)
+ }
+
+ // Add AVX10 features.
+ if fs.inSet(AVX10) && mfi >= 0x24 {
+ _, ebx, _, _ := cpuidex(0x24, 0)
+ fs.setIf(ebx&(1<<16) != 0, AVX10_128)
+ fs.setIf(ebx&(1<<17) != 0, AVX10_256)
+ fs.setIf(ebx&(1<<18) != 0, AVX10_512)
+ }
}
// Processor Extended State Enumeration Sub-leaf (EAX = 0DH, ECX = 1)
@@ -1394,6 +1452,29 @@ func support() flagSet {
fs.setIf((a>>24)&1 == 1, VMSA_REGPROT)
}
+ if maxExtendedFunction() >= 0x80000021 && vend == AMD {
+ a, _, _, _ := cpuid(0x80000021)
+ fs.setIf((a>>31)&1 == 1, SRSO_MSR_FIX)
+ fs.setIf((a>>30)&1 == 1, SRSO_USER_KERNEL_NO)
+ fs.setIf((a>>29)&1 == 1, SRSO_NO)
+ fs.setIf((a>>28)&1 == 1, IBPB_BRTYPE)
+ fs.setIf((a>>27)&1 == 1, SBPB)
+ }
+
+ if mfi >= 0x20 {
+ // Microsoft has decided to purposefully hide the information
+ // of the guest TEE when VMs are being created using Hyper-V.
+ //
+ // This leads us to check for the Hyper-V cpuid features
+ // (0x4000000C), and then for the `ebx` value set.
+ //
+ // For Intel TDX, `ebx` is set as `0xbe3`, being 3 the part
+ // we're mostly interested about,according to:
+ // https://github.com/torvalds/linux/blob/d2f51b3516dade79269ff45eae2a7668ae711b25/arch/x86/include/asm/hyperv-tlfs.h#L169-L174
+ _, ebx, _, _ := cpuid(0x4000000C)
+ fs.setIf(ebx == 0xbe3, TDX_GUEST)
+ }
+
if mfi >= 0x21 {
// Intel Trusted Domain Extensions Guests have their own cpuid leaf (0x21).
_, ebx, ecx, edx := cpuid(0x21)
@@ -1404,6 +1485,14 @@ func support() flagSet {
return fs
}
+func (c *CPUInfo) supportAVX10() uint8 {
+ if c.maxFunc >= 0x24 && c.featureSet.inSet(AVX10) {
+ _, ebx, _, _ := cpuidex(0x24, 0)
+ return uint8(ebx)
+ }
+ return 0
+}
+
func valAsString(values ...uint32) []byte {
r := make([]byte, 4*len(values))
for i, v := range values {
diff --git a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go
index c946824ec..799b400c2 100644
--- a/vendor/github.com/klauspost/cpuid/v2/detect_x86.go
+++ b/vendor/github.com/klauspost/cpuid/v2/detect_x86.go
@@ -27,10 +27,12 @@ func addInfo(c *CPUInfo, safe bool) {
c.Family, c.Model, c.Stepping = familyModel()
c.featureSet = support()
c.SGX = hasSGX(c.featureSet.inSet(SGX), c.featureSet.inSet(SGXLC))
+ c.AMDMemEncryption = hasAMDMemEncryption(c.featureSet.inSet(SME) || c.featureSet.inSet(SEV))
c.ThreadsPerCore = threadsPerCore()
c.LogicalCores = logicalCores()
c.PhysicalCores = physicalCores()
c.VendorID, c.VendorString = vendorID()
+ c.AVX10Level = c.supportAVX10()
c.cacheSize()
c.frequencies()
}
diff --git a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go
index 024c706af..3a2560310 100644
--- a/vendor/github.com/klauspost/cpuid/v2/featureid_string.go
+++ b/vendor/github.com/klauspost/cpuid/v2/featureid_string.go
@@ -16,210 +16,223 @@ func _() {
_ = x[AMXFP16-6]
_ = x[AMXINT8-7]
_ = x[AMXTILE-8]
- _ = x[AVX-9]
- _ = x[AVX2-10]
- _ = x[AVX512BF16-11]
- _ = x[AVX512BITALG-12]
- _ = x[AVX512BW-13]
- _ = x[AVX512CD-14]
- _ = x[AVX512DQ-15]
- _ = x[AVX512ER-16]
- _ = x[AVX512F-17]
- _ = x[AVX512FP16-18]
- _ = x[AVX512IFMA-19]
- _ = x[AVX512PF-20]
- _ = x[AVX512VBMI-21]
- _ = x[AVX512VBMI2-22]
- _ = x[AVX512VL-23]
- _ = x[AVX512VNNI-24]
- _ = x[AVX512VP2INTERSECT-25]
- _ = x[AVX512VPOPCNTDQ-26]
- _ = x[AVXIFMA-27]
- _ = x[AVXNECONVERT-28]
- _ = x[AVXSLOW-29]
- _ = x[AVXVNNI-30]
- _ = x[AVXVNNIINT8-31]
- _ = x[BHI_CTRL-32]
- _ = x[BMI1-33]
- _ = x[BMI2-34]
- _ = x[CETIBT-35]
- _ = x[CETSS-36]
- _ = x[CLDEMOTE-37]
- _ = x[CLMUL-38]
- _ = x[CLZERO-39]
- _ = x[CMOV-40]
- _ = x[CMPCCXADD-41]
- _ = x[CMPSB_SCADBS_SHORT-42]
- _ = x[CMPXCHG8-43]
- _ = x[CPBOOST-44]
- _ = x[CPPC-45]
- _ = x[CX16-46]
- _ = x[EFER_LMSLE_UNS-47]
- _ = x[ENQCMD-48]
- _ = x[ERMS-49]
- _ = x[F16C-50]
- _ = x[FLUSH_L1D-51]
- _ = x[FMA3-52]
- _ = x[FMA4-53]
- _ = x[FP128-54]
- _ = x[FP256-55]
- _ = x[FSRM-56]
- _ = x[FXSR-57]
- _ = x[FXSROPT-58]
- _ = x[GFNI-59]
- _ = x[HLE-60]
- _ = x[HRESET-61]
- _ = x[HTT-62]
- _ = x[HWA-63]
- _ = x[HYBRID_CPU-64]
- _ = x[HYPERVISOR-65]
- _ = x[IA32_ARCH_CAP-66]
- _ = x[IA32_CORE_CAP-67]
- _ = x[IBPB-68]
- _ = x[IBRS-69]
- _ = x[IBRS_PREFERRED-70]
- _ = x[IBRS_PROVIDES_SMP-71]
- _ = x[IBS-72]
- _ = x[IBSBRNTRGT-73]
- _ = x[IBSFETCHSAM-74]
- _ = x[IBSFFV-75]
- _ = x[IBSOPCNT-76]
- _ = x[IBSOPCNTEXT-77]
- _ = x[IBSOPSAM-78]
- _ = x[IBSRDWROPCNT-79]
- _ = x[IBSRIPINVALIDCHK-80]
- _ = x[IBS_FETCH_CTLX-81]
- _ = x[IBS_OPDATA4-82]
- _ = x[IBS_OPFUSE-83]
- _ = x[IBS_PREVENTHOST-84]
- _ = x[IBS_ZEN4-85]
- _ = x[IDPRED_CTRL-86]
- _ = x[INT_WBINVD-87]
- _ = x[INVLPGB-88]
- _ = x[LAHF-89]
- _ = x[LAM-90]
- _ = x[LBRVIRT-91]
- _ = x[LZCNT-92]
- _ = x[MCAOVERFLOW-93]
- _ = x[MCDT_NO-94]
- _ = x[MCOMMIT-95]
- _ = x[MD_CLEAR-96]
- _ = x[MMX-97]
- _ = x[MMXEXT-98]
- _ = x[MOVBE-99]
- _ = x[MOVDIR64B-100]
- _ = x[MOVDIRI-101]
- _ = x[MOVSB_ZL-102]
- _ = x[MOVU-103]
- _ = x[MPX-104]
- _ = x[MSRIRC-105]
- _ = x[MSRLIST-106]
- _ = x[MSR_PAGEFLUSH-107]
- _ = x[NRIPS-108]
- _ = x[NX-109]
- _ = x[OSXSAVE-110]
- _ = x[PCONFIG-111]
- _ = x[POPCNT-112]
- _ = x[PPIN-113]
- _ = x[PREFETCHI-114]
- _ = x[PSFD-115]
- _ = x[RDPRU-116]
- _ = x[RDRAND-117]
- _ = x[RDSEED-118]
- _ = x[RDTSCP-119]
- _ = x[RRSBA_CTRL-120]
- _ = x[RTM-121]
- _ = x[RTM_ALWAYS_ABORT-122]
- _ = x[SERIALIZE-123]
- _ = x[SEV-124]
- _ = x[SEV_64BIT-125]
- _ = x[SEV_ALTERNATIVE-126]
- _ = x[SEV_DEBUGSWAP-127]
- _ = x[SEV_ES-128]
- _ = x[SEV_RESTRICTED-129]
- _ = x[SEV_SNP-130]
- _ = x[SGX-131]
- _ = x[SGXLC-132]
- _ = x[SHA-133]
- _ = x[SME-134]
- _ = x[SME_COHERENT-135]
- _ = x[SPEC_CTRL_SSBD-136]
- _ = x[SRBDS_CTRL-137]
- _ = x[SSE-138]
- _ = x[SSE2-139]
- _ = x[SSE3-140]
- _ = x[SSE4-141]
- _ = x[SSE42-142]
- _ = x[SSE4A-143]
- _ = x[SSSE3-144]
- _ = x[STIBP-145]
- _ = x[STIBP_ALWAYSON-146]
- _ = x[STOSB_SHORT-147]
- _ = x[SUCCOR-148]
- _ = x[SVM-149]
- _ = x[SVMDA-150]
- _ = x[SVMFBASID-151]
- _ = x[SVML-152]
- _ = x[SVMNP-153]
- _ = x[SVMPF-154]
- _ = x[SVMPFT-155]
- _ = x[SYSCALL-156]
- _ = x[SYSEE-157]
- _ = x[TBM-158]
- _ = x[TDX_GUEST-159]
- _ = x[TLB_FLUSH_NESTED-160]
- _ = x[TME-161]
- _ = x[TOPEXT-162]
- _ = x[TSCRATEMSR-163]
- _ = x[TSXLDTRK-164]
- _ = x[VAES-165]
- _ = x[VMCBCLEAN-166]
- _ = x[VMPL-167]
- _ = x[VMSA_REGPROT-168]
- _ = x[VMX-169]
- _ = x[VPCLMULQDQ-170]
- _ = x[VTE-171]
- _ = x[WAITPKG-172]
- _ = x[WBNOINVD-173]
- _ = x[WRMSRNS-174]
- _ = x[X87-175]
- _ = x[XGETBV1-176]
- _ = x[XOP-177]
- _ = x[XSAVE-178]
- _ = x[XSAVEC-179]
- _ = x[XSAVEOPT-180]
- _ = x[XSAVES-181]
- _ = x[AESARM-182]
- _ = x[ARMCPUID-183]
- _ = x[ASIMD-184]
- _ = x[ASIMDDP-185]
- _ = x[ASIMDHP-186]
- _ = x[ASIMDRDM-187]
- _ = x[ATOMICS-188]
- _ = x[CRC32-189]
- _ = x[DCPOP-190]
- _ = x[EVTSTRM-191]
- _ = x[FCMA-192]
- _ = x[FP-193]
- _ = x[FPHP-194]
- _ = x[GPA-195]
- _ = x[JSCVT-196]
- _ = x[LRCPC-197]
- _ = x[PMULL-198]
- _ = x[SHA1-199]
- _ = x[SHA2-200]
- _ = x[SHA3-201]
- _ = x[SHA512-202]
- _ = x[SM3-203]
- _ = x[SM4-204]
- _ = x[SVE-205]
- _ = x[lastID-206]
+ _ = x[APX_F-9]
+ _ = x[AVX-10]
+ _ = x[AVX10-11]
+ _ = x[AVX10_128-12]
+ _ = x[AVX10_256-13]
+ _ = x[AVX10_512-14]
+ _ = x[AVX2-15]
+ _ = x[AVX512BF16-16]
+ _ = x[AVX512BITALG-17]
+ _ = x[AVX512BW-18]
+ _ = x[AVX512CD-19]
+ _ = x[AVX512DQ-20]
+ _ = x[AVX512ER-21]
+ _ = x[AVX512F-22]
+ _ = x[AVX512FP16-23]
+ _ = x[AVX512IFMA-24]
+ _ = x[AVX512PF-25]
+ _ = x[AVX512VBMI-26]
+ _ = x[AVX512VBMI2-27]
+ _ = x[AVX512VL-28]
+ _ = x[AVX512VNNI-29]
+ _ = x[AVX512VP2INTERSECT-30]
+ _ = x[AVX512VPOPCNTDQ-31]
+ _ = x[AVXIFMA-32]
+ _ = x[AVXNECONVERT-33]
+ _ = x[AVXSLOW-34]
+ _ = x[AVXVNNI-35]
+ _ = x[AVXVNNIINT8-36]
+ _ = x[AVXVNNIINT16-37]
+ _ = x[BHI_CTRL-38]
+ _ = x[BMI1-39]
+ _ = x[BMI2-40]
+ _ = x[CETIBT-41]
+ _ = x[CETSS-42]
+ _ = x[CLDEMOTE-43]
+ _ = x[CLMUL-44]
+ _ = x[CLZERO-45]
+ _ = x[CMOV-46]
+ _ = x[CMPCCXADD-47]
+ _ = x[CMPSB_SCADBS_SHORT-48]
+ _ = x[CMPXCHG8-49]
+ _ = x[CPBOOST-50]
+ _ = x[CPPC-51]
+ _ = x[CX16-52]
+ _ = x[EFER_LMSLE_UNS-53]
+ _ = x[ENQCMD-54]
+ _ = x[ERMS-55]
+ _ = x[F16C-56]
+ _ = x[FLUSH_L1D-57]
+ _ = x[FMA3-58]
+ _ = x[FMA4-59]
+ _ = x[FP128-60]
+ _ = x[FP256-61]
+ _ = x[FSRM-62]
+ _ = x[FXSR-63]
+ _ = x[FXSROPT-64]
+ _ = x[GFNI-65]
+ _ = x[HLE-66]
+ _ = x[HRESET-67]
+ _ = x[HTT-68]
+ _ = x[HWA-69]
+ _ = x[HYBRID_CPU-70]
+ _ = x[HYPERVISOR-71]
+ _ = x[IA32_ARCH_CAP-72]
+ _ = x[IA32_CORE_CAP-73]
+ _ = x[IBPB-74]
+ _ = x[IBPB_BRTYPE-75]
+ _ = x[IBRS-76]
+ _ = x[IBRS_PREFERRED-77]
+ _ = x[IBRS_PROVIDES_SMP-78]
+ _ = x[IBS-79]
+ _ = x[IBSBRNTRGT-80]
+ _ = x[IBSFETCHSAM-81]
+ _ = x[IBSFFV-82]
+ _ = x[IBSOPCNT-83]
+ _ = x[IBSOPCNTEXT-84]
+ _ = x[IBSOPSAM-85]
+ _ = x[IBSRDWROPCNT-86]
+ _ = x[IBSRIPINVALIDCHK-87]
+ _ = x[IBS_FETCH_CTLX-88]
+ _ = x[IBS_OPDATA4-89]
+ _ = x[IBS_OPFUSE-90]
+ _ = x[IBS_PREVENTHOST-91]
+ _ = x[IBS_ZEN4-92]
+ _ = x[IDPRED_CTRL-93]
+ _ = x[INT_WBINVD-94]
+ _ = x[INVLPGB-95]
+ _ = x[KEYLOCKER-96]
+ _ = x[KEYLOCKERW-97]
+ _ = x[LAHF-98]
+ _ = x[LAM-99]
+ _ = x[LBRVIRT-100]
+ _ = x[LZCNT-101]
+ _ = x[MCAOVERFLOW-102]
+ _ = x[MCDT_NO-103]
+ _ = x[MCOMMIT-104]
+ _ = x[MD_CLEAR-105]
+ _ = x[MMX-106]
+ _ = x[MMXEXT-107]
+ _ = x[MOVBE-108]
+ _ = x[MOVDIR64B-109]
+ _ = x[MOVDIRI-110]
+ _ = x[MOVSB_ZL-111]
+ _ = x[MOVU-112]
+ _ = x[MPX-113]
+ _ = x[MSRIRC-114]
+ _ = x[MSRLIST-115]
+ _ = x[MSR_PAGEFLUSH-116]
+ _ = x[NRIPS-117]
+ _ = x[NX-118]
+ _ = x[OSXSAVE-119]
+ _ = x[PCONFIG-120]
+ _ = x[POPCNT-121]
+ _ = x[PPIN-122]
+ _ = x[PREFETCHI-123]
+ _ = x[PSFD-124]
+ _ = x[RDPRU-125]
+ _ = x[RDRAND-126]
+ _ = x[RDSEED-127]
+ _ = x[RDTSCP-128]
+ _ = x[RRSBA_CTRL-129]
+ _ = x[RTM-130]
+ _ = x[RTM_ALWAYS_ABORT-131]
+ _ = x[SBPB-132]
+ _ = x[SERIALIZE-133]
+ _ = x[SEV-134]
+ _ = x[SEV_64BIT-135]
+ _ = x[SEV_ALTERNATIVE-136]
+ _ = x[SEV_DEBUGSWAP-137]
+ _ = x[SEV_ES-138]
+ _ = x[SEV_RESTRICTED-139]
+ _ = x[SEV_SNP-140]
+ _ = x[SGX-141]
+ _ = x[SGXLC-142]
+ _ = x[SHA-143]
+ _ = x[SME-144]
+ _ = x[SME_COHERENT-145]
+ _ = x[SPEC_CTRL_SSBD-146]
+ _ = x[SRBDS_CTRL-147]
+ _ = x[SRSO_MSR_FIX-148]
+ _ = x[SRSO_NO-149]
+ _ = x[SRSO_USER_KERNEL_NO-150]
+ _ = x[SSE-151]
+ _ = x[SSE2-152]
+ _ = x[SSE3-153]
+ _ = x[SSE4-154]
+ _ = x[SSE42-155]
+ _ = x[SSE4A-156]
+ _ = x[SSSE3-157]
+ _ = x[STIBP-158]
+ _ = x[STIBP_ALWAYSON-159]
+ _ = x[STOSB_SHORT-160]
+ _ = x[SUCCOR-161]
+ _ = x[SVM-162]
+ _ = x[SVMDA-163]
+ _ = x[SVMFBASID-164]
+ _ = x[SVML-165]
+ _ = x[SVMNP-166]
+ _ = x[SVMPF-167]
+ _ = x[SVMPFT-168]
+ _ = x[SYSCALL-169]
+ _ = x[SYSEE-170]
+ _ = x[TBM-171]
+ _ = x[TDX_GUEST-172]
+ _ = x[TLB_FLUSH_NESTED-173]
+ _ = x[TME-174]
+ _ = x[TOPEXT-175]
+ _ = x[TSCRATEMSR-176]
+ _ = x[TSXLDTRK-177]
+ _ = x[VAES-178]
+ _ = x[VMCBCLEAN-179]
+ _ = x[VMPL-180]
+ _ = x[VMSA_REGPROT-181]
+ _ = x[VMX-182]
+ _ = x[VPCLMULQDQ-183]
+ _ = x[VTE-184]
+ _ = x[WAITPKG-185]
+ _ = x[WBNOINVD-186]
+ _ = x[WRMSRNS-187]
+ _ = x[X87-188]
+ _ = x[XGETBV1-189]
+ _ = x[XOP-190]
+ _ = x[XSAVE-191]
+ _ = x[XSAVEC-192]
+ _ = x[XSAVEOPT-193]
+ _ = x[XSAVES-194]
+ _ = x[AESARM-195]
+ _ = x[ARMCPUID-196]
+ _ = x[ASIMD-197]
+ _ = x[ASIMDDP-198]
+ _ = x[ASIMDHP-199]
+ _ = x[ASIMDRDM-200]
+ _ = x[ATOMICS-201]
+ _ = x[CRC32-202]
+ _ = x[DCPOP-203]
+ _ = x[EVTSTRM-204]
+ _ = x[FCMA-205]
+ _ = x[FP-206]
+ _ = x[FPHP-207]
+ _ = x[GPA-208]
+ _ = x[JSCVT-209]
+ _ = x[LRCPC-210]
+ _ = x[PMULL-211]
+ _ = x[SHA1-212]
+ _ = x[SHA2-213]
+ _ = x[SHA3-214]
+ _ = x[SHA512-215]
+ _ = x[SM3-216]
+ _ = x[SM4-217]
+ _ = x[SVE-218]
+ _ = x[lastID-219]
_ = x[firstID-0]
}
-const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAVXAVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
+const _FeatureID_name = "firstIDADXAESNIAMD3DNOWAMD3DNOWEXTAMXBF16AMXFP16AMXINT8AMXTILEAPX_FAVXAVX10AVX10_128AVX10_256AVX10_512AVX2AVX512BF16AVX512BITALGAVX512BWAVX512CDAVX512DQAVX512ERAVX512FAVX512FP16AVX512IFMAAVX512PFAVX512VBMIAVX512VBMI2AVX512VLAVX512VNNIAVX512VP2INTERSECTAVX512VPOPCNTDQAVXIFMAAVXNECONVERTAVXSLOWAVXVNNIAVXVNNIINT8AVXVNNIINT16BHI_CTRLBMI1BMI2CETIBTCETSSCLDEMOTECLMULCLZEROCMOVCMPCCXADDCMPSB_SCADBS_SHORTCMPXCHG8CPBOOSTCPPCCX16EFER_LMSLE_UNSENQCMDERMSF16CFLUSH_L1DFMA3FMA4FP128FP256FSRMFXSRFXSROPTGFNIHLEHRESETHTTHWAHYBRID_CPUHYPERVISORIA32_ARCH_CAPIA32_CORE_CAPIBPBIBPB_BRTYPEIBRSIBRS_PREFERREDIBRS_PROVIDES_SMPIBSIBSBRNTRGTIBSFETCHSAMIBSFFVIBSOPCNTIBSOPCNTEXTIBSOPSAMIBSRDWROPCNTIBSRIPINVALIDCHKIBS_FETCH_CTLXIBS_OPDATA4IBS_OPFUSEIBS_PREVENTHOSTIBS_ZEN4IDPRED_CTRLINT_WBINVDINVLPGBKEYLOCKERKEYLOCKERWLAHFLAMLBRVIRTLZCNTMCAOVERFLOWMCDT_NOMCOMMITMD_CLEARMMXMMXEXTMOVBEMOVDIR64BMOVDIRIMOVSB_ZLMOVUMPXMSRIRCMSRLISTMSR_PAGEFLUSHNRIPSNXOSXSAVEPCONFIGPOPCNTPPINPREFETCHIPSFDRDPRURDRANDRDSEEDRDTSCPRRSBA_CTRLRTMRTM_ALWAYS_ABORTSBPBSERIALIZESEVSEV_64BITSEV_ALTERNATIVESEV_DEBUGSWAPSEV_ESSEV_RESTRICTEDSEV_SNPSGXSGXLCSHASMESME_COHERENTSPEC_CTRL_SSBDSRBDS_CTRLSRSO_MSR_FIXSRSO_NOSRSO_USER_KERNEL_NOSSESSE2SSE3SSE4SSE42SSE4ASSSE3STIBPSTIBP_ALWAYSONSTOSB_SHORTSUCCORSVMSVMDASVMFBASIDSVMLSVMNPSVMPFSVMPFTSYSCALLSYSEETBMTDX_GUESTTLB_FLUSH_NESTEDTMETOPEXTTSCRATEMSRTSXLDTRKVAESVMCBCLEANVMPLVMSA_REGPROTVMXVPCLMULQDQVTEWAITPKGWBNOINVDWRMSRNSX87XGETBV1XOPXSAVEXSAVECXSAVEOPTXSAVESAESARMARMCPUIDASIMDASIMDDPASIMDHPASIMDRDMATOMICSCRC32DCPOPEVTSTRMFCMAFPFPHPGPAJSCVTLRCPCPMULLSHA1SHA2SHA3SHA512SM3SM4SVElastID"
-var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 65, 69, 79, 91, 99, 107, 115, 123, 130, 140, 150, 158, 168, 179, 187, 197, 215, 230, 237, 249, 256, 263, 274, 282, 286, 290, 296, 301, 309, 314, 320, 324, 333, 351, 359, 366, 370, 374, 388, 394, 398, 402, 411, 415, 419, 424, 429, 433, 437, 444, 448, 451, 457, 460, 463, 473, 483, 496, 509, 513, 517, 531, 548, 551, 561, 572, 578, 586, 597, 605, 617, 633, 647, 658, 668, 683, 691, 702, 712, 719, 723, 726, 733, 738, 749, 756, 763, 771, 774, 780, 785, 794, 801, 809, 813, 816, 822, 829, 842, 847, 849, 856, 863, 869, 873, 882, 886, 891, 897, 903, 909, 919, 922, 938, 947, 950, 959, 974, 987, 993, 1007, 1014, 1017, 1022, 1025, 1028, 1040, 1054, 1064, 1067, 1071, 1075, 1079, 1084, 1089, 1094, 1099, 1113, 1124, 1130, 1133, 1138, 1147, 1151, 1156, 1161, 1167, 1174, 1179, 1182, 1191, 1207, 1210, 1216, 1226, 1234, 1238, 1247, 1251, 1263, 1266, 1276, 1279, 1286, 1294, 1301, 1304, 1311, 1314, 1319, 1325, 1333, 1339, 1345, 1353, 1358, 1365, 1372, 1380, 1387, 1392, 1397, 1404, 1408, 1410, 1414, 1417, 1422, 1427, 1432, 1436, 1440, 1444, 1450, 1453, 1456, 1459, 1465}
+var _FeatureID_index = [...]uint16{0, 7, 10, 15, 23, 34, 41, 48, 55, 62, 67, 70, 75, 84, 93, 102, 106, 116, 128, 136, 144, 152, 160, 167, 177, 187, 195, 205, 216, 224, 234, 252, 267, 274, 286, 293, 300, 311, 323, 331, 335, 339, 345, 350, 358, 363, 369, 373, 382, 400, 408, 415, 419, 423, 437, 443, 447, 451, 460, 464, 468, 473, 478, 482, 486, 493, 497, 500, 506, 509, 512, 522, 532, 545, 558, 562, 573, 577, 591, 608, 611, 621, 632, 638, 646, 657, 665, 677, 693, 707, 718, 728, 743, 751, 762, 772, 779, 788, 798, 802, 805, 812, 817, 828, 835, 842, 850, 853, 859, 864, 873, 880, 888, 892, 895, 901, 908, 921, 926, 928, 935, 942, 948, 952, 961, 965, 970, 976, 982, 988, 998, 1001, 1017, 1021, 1030, 1033, 1042, 1057, 1070, 1076, 1090, 1097, 1100, 1105, 1108, 1111, 1123, 1137, 1147, 1159, 1166, 1185, 1188, 1192, 1196, 1200, 1205, 1210, 1215, 1220, 1234, 1245, 1251, 1254, 1259, 1268, 1272, 1277, 1282, 1288, 1295, 1300, 1303, 1312, 1328, 1331, 1337, 1347, 1355, 1359, 1368, 1372, 1384, 1387, 1397, 1400, 1407, 1415, 1422, 1425, 1432, 1435, 1440, 1446, 1454, 1460, 1466, 1474, 1479, 1486, 1493, 1501, 1508, 1513, 1518, 1525, 1529, 1531, 1535, 1538, 1543, 1548, 1553, 1557, 1561, 1565, 1571, 1574, 1577, 1580, 1586}
func (i FeatureID) String() string {
if i < 0 || i >= FeatureID(len(_FeatureID_index)-1) {